Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y96A_

Fold library idPDB HeaderMoleculeTitle
c5y96A_1.80PDB header: transferaseChain: A: PDB Molecule: receptor-like protein kinase anxur1;


Added to library: Sat Mar 3 08:34:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QDLALSCGTSEASADQDKKKWEPDTKFLKTGNSIHATATYQDPSLLSTVPYMTARIFTAPATYEIPIKGD
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)

TT
SS

TT

SGGGS


S


TT
S
STTTTSS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KRHLLRLYFYPSTYTGLNISNSYFTVEANDVTLLSNFSAAITCQALTQAYLVKEYSLAPTDKDVLSIKFT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S



BTTB
GGG

TT
TT
S



SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PSDKYRDAFAFINGIEVIQMPELFDTAALVGFTDQTMDAKTANLQSMFRLNVGGQDIPGSQDSGGLTRTW
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
SSSTT

S




TTSSS

TT

TTS

B
GGG
STT



B
 .........220.........230.........240.........250.........260.........270.........280
Sequence YNDAPYIFSAGLGVTLQASNNFRINYQNMPVSIAPADIYKTARSQGPNGDINLKSNLTWMFQIDKNFTYI
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) SGGGB
SSS



TT




TTS
GGGS
T

S
T



SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LRLHFCEFQLSKINQKVFNIYINNRTAQADTTPADIIGWTGEKGIPMYKDYAIYVDAGEEITLQMTPSTF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SS

STTSS
TTSS
TTS
B
SSTT







T
 .........360.........370.........380.
Sequence GQPEYYDSSLNGLEIFKMDTMKNLAGPNPEP
Predicted secondary structure



















SS confidence






























Known secondary structure (DSSP) T

S





BTTB








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D