Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y96A_

Fold library idPDB HeaderMoleculeTitle
c5y96A_1.80PDB header: transferaseChain: A: PDB Molecule: receptor-like protein kinase anxur1;


Added to library: Sat Mar 3 08:34:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QDLALSCGTSEASADQDKKKWEPDTKFLKTGNSIHATATYQDPSLLSTVPYMTARIFTAPATYEIPIKGD
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)

TT
SS

TT

SGGGS


S


TT
S
STTTTSS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KRHLLRLYFYPSTYTGLNISNSYFTVEANDVTLLSNFSAAITCQALTQAYLVKEYSLAPTDKDVLSIKFT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S



BTTB
GGG

TT
TT
S



SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PSDKYRDAFAFINGIEVIQMPELFDTAALVGFTDQTMDAKTANLQSMFRLNVGGQDIPGSQDSGGLTRTW
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
SSSTT

S




TTSSS

TT

TTS

B
GGG
STT



B
 .........220.........230.........240.........250.........260.........270.........280
Sequence YNDAPYIFSAGLGVTLQASNNFRINYQNMPVSIAPADIYKTARSQGPNGDINLKSNLTWMFQIDKNFTYI
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) SGGGB
SSS



TT




TTS
GGGS
T

S
T



SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LRLHFCEFQLSKINQKVFNIYINNRTAQADTTPADIIGWTGEKGIPMYKDYAIYVDAGEEITLQMTPSTF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SS

STTSS
TTSS
TTS
B
SSTT







T
 .........360.........370.........380.
Sequence GQPEYYDSSLNGLEIFKMDTMKNLAGPNPEP
Predicted secondary structure



















SS confidence






























Known secondary structure (DSSP) T

S





BTTB








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D