Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y6qC_

Fold library idPDB HeaderMoleculeTitle
c5y6qC_2.50PDB header: oxidoreductaseChain: C: PDB Molecule: aldehyde oxidase large subunit;


Added to library: Sat Jan 27 08:31:14 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSPIEGLGAARSRGDGRVKVIGEARYAIEHQPENPLYGVVLQSTVASGRISRLSAEKALQADGVLAVYTH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

TT

TT




TTTT
S

GGGS

SS

SSSS
TSTTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LNPLKINKPTAIADGGAAQSTYTPIQDDVIIHNGQNIGIVIAETFEQATWAASLVEIEYETTPARVFATD
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SS







BGGGTSSBS



TTSSS
STT
SSTT





STTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EGVEAKPMSAQDIDLGDAATAMHSAEVRINQRYTTPREYNMPMEPHACIAHWHEGQITVWEPSQWVAGAQ
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT
S
T
S

B



SS
STT


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence VEIAEWLGIETEKVRIISPYVGGGFGSKPVPYTHVALASVASRALNRPVKVSLTRPQTFTGLGGRPATSQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS
GGG
S




TTS
SS

TS


TGGGGTSS

B

 .........290.........300.........310.........320.........330.........340.........350
Sequence QLELGASRDGKIEAIIQRSFSETSLIDVFAENCSKVTARMYAVSNVSAQHQVRLINTVTPGWMRAPGENP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTS

SS





TTTTTTTSS

S

SS





SSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SAFGLEVAMDELAYALDIDPLELRLRNWADKDYQLDLPWSTRRLKEAYQKGAEAFGWDKRIMTPRSMREG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T

T

SSBTTTTB
BS


TGGG


STT

T
 .........430.........440.........450.........460.........470.........480.........490
Sequence RELIGWGMASGTYPVNRLPAEAKIILTPQGRFVVQCAGADIGTGTYTILAQTAADHLGVGSETIEVELGD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T

B



TTS





SSS
SS
GGG

SB
 .........500.........510.........520.........530.........540.........550.........560
Sequence TALPRAGVAGGSQLAGNLTAAVNDTAKKMRERLLALASELPASPLSGLPVSQFTLQDGAIQHSGGSGLSL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTSS



S
TT

TTSTTTT

GGGTTTTS
 .........570.........580.........590.........600.........610.........620.........630
Sequence AQLATLAPPDSLSVKGGTFPDDMPQSERDKIVRNLNDMSRPEAFSAHSWSAQFVEVRVDEDFGTIRVKRM
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
GGGGSS
TT

TSSTT
B

SSSB
TTT

 .........640.........650.........660.........670.........680.........690.........700
Sequence VAALDSGRLYNPKLARSQWIGGMIMGVGQALMEEGIVDPRNGRVINNNLADYLVPVNGDIPSITTINVGE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
BS
SST



B
TTT

BTT
STTTS



GGG





 .........710.........720.........730.........740........
Sequence PDFEATTMGGKAVGELGIVGVAAAISNAVFHATGKRVRGLPITLDKII
Predicted secondary structure





























SS confidence















































Known secondary structure (DSSP)

TTT
TTSB


TTGGGTTS



BS


GGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D