Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y6qB_

Fold library idPDB HeaderMoleculeTitle
c5y6qB_2.50PDB header: oxidoreductaseChain: B: PDB Molecule: aldehyde oxidase medium subunit;


Added to library: Sat Jan 27 08:21:36 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNPFHWKVAQSASEAAALKQQSGSQILAGGTTQLDLMKCGVFNPPQLIGINGLSELRSLSFDNDKISAGA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)




SSTSTT
SS
TTTS


S
TT
GGGG


SST
 .........80.........90.........100.........110.........120.........130.........140
Sequence LITMSQLADHPDCQQHAPAIYGSLWQAASPQIRNMATLGGNLRQRTRCAYYRDPATFSACNKRNPGSGCA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T
BSTT
TSS

BT




TTTT
TTT


BTTTSTTS
BT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ARQGVNSNHAILGASDSCIAVYPGDLAVALVAFDAVVIVQNPQGETRRIAIDDFFLLPGETPDQEHDLRD
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TSSS

TTS
SBS

SS






STT

TT

B


TT
TT

BS

T
 .........220.........230.........240.........250.........260.........270.........280
Sequence DEIIVAIEVPQTASLQRSHYLKVRDRSSYEFAAASAAAGFTLENGVMRQVHIALGGVATKPWRATRVEQA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T


S
SSSSSS

S
SSSSSBSS

 .........290.........300.........310.........320.........330
Sequence LEGQPFNEETVFQAAELINQETQALEHNAYKVKLAPRVIARALMAAGEIA
Predicted secondary structure

















SS confidence

















































Known secondary structure (DSSP) TTB


GGGGGT



SS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D