Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y6qB_

Fold library idPDB HeaderMoleculeTitle
c5y6qB_2.50PDB header: oxidoreductaseChain: B: PDB Molecule: aldehyde oxidase medium subunit;


Added to library: Sat Jan 27 08:21:36 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNPFHWKVAQSASEAAALKQQSGSQILAGGTTQLDLMKCGVFNPPQLIGINGLSELRSLSFDNDKISAGA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)




SSTSTT
SS
TTTS


S
TT
GGGG


SST
 .........80.........90.........100.........110.........120.........130.........140
Sequence LITMSQLADHPDCQQHAPAIYGSLWQAASPQIRNMATLGGNLRQRTRCAYYRDPATFSACNKRNPGSGCA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T
BSTT
TSS

BT




TTTT
TTT


BTTTSTTS
BT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ARQGVNSNHAILGASDSCIAVYPGDLAVALVAFDAVVIVQNPQGETRRIAIDDFFLLPGETPDQEHDLRD
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TSSS

TTS
SBS

SS






STT

TT

B


TT
TT

BS

T
 .........220.........230.........240.........250.........260.........270.........280
Sequence DEIIVAIEVPQTASLQRSHYLKVRDRSSYEFAAASAAAGFTLENGVMRQVHIALGGVATKPWRATRVEQA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T


S
SSSSSS

S
SSSSSBSS

 .........290.........300.........310.........320.........330
Sequence LEGQPFNEETVFQAAELINQETQALEHNAYKVKLAPRVIARALMAAGEIA
Predicted secondary structure

















SS confidence

















































Known secondary structure (DSSP) TTB


GGGGGT



SS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D