Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y5aA_

Fold library idPDB HeaderMoleculeTitle
c5y5aA_2.21PDB header: protein bindingChain: A: PDB Molecule: klla0f20702p;


Added to library: Sat Dec 23 08:38:45 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TDLQETFSGFQKQLQSVDSLMKGAIQMIHSKIMQMLLQSLISDAHRILDLTWKHVHYPIFKYFQNWRNRN
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP)






T
 .........80.........90.........100.........110.........120.........130.........140
Sequence VAPNYAGHRQLNSILQKIFPQIHKLYYSTLELIFANYNLTALIPSDTRSKLNISTDASNVLKPEDSFSID
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)



B
TTTS
TTTT




TTB

TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence CVMASQRCLLYIGCSQRYKIIMEHLSDRYQQADFQKPLRYLDIASTIVPSVGETFLQRGICYTHTKNFGN
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
SSS


GGGG
TTBTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence AAYQFVRSSLSRLPSDAGIPNFTNLLGDPNGSLFKKLLNSLDDLKVQETIKKRIINMEIMEFYILPLIGS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) BSB

TTT
TT
TTTT


TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence HIFPQTWKNNRHSDRLKHFQTLLFDKIEIRYIKNISMIFQDLILLIGSFHMYQMINGVSSNIRSIQSETK
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) STTTTTSSTTGGG
S

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence FLEFIFKFFTHLIDKVIMKEFKNCEMFQYLAMARIMMCWIKSHKNVLKFAHRSTSFCQSMVNLTNELLSS
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TGGGTTT
SS
TTT
T

 .........430.........440.........450.........460.........470.........480.........490
Sequence HRPTRDYFYEEDIMLKEFGPTKFTLSDFNDEKLLSMDNLPDRLVGKSKNKLTAKEEHSSRVQVLVYSNKK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)




SS

TTTBGGGTTS

SS

GGGGGSSSTTT

S



 .........500.........510....
Sequence FLEKNCCGFKLDTEKKRYVHTAVK
Predicted secondary structure













SS confidence























Known secondary structure (DSSP) T
SS
TTTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D