Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y59B_

Fold library idPDB HeaderMoleculeTitle
c5y59B_2.40PDB header: protein bindingChain: B: PDB Molecule: atp-dependent dna helicase ii subunit 2;


Added to library: Sat Dec 23 08:25:53 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SSESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQEIPNVFQIQSF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



TTTS
TT
S
S

BSTT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LAPVTTTATIGFIKRLKQYCDQHSHDSSNEGLQSMIQCLLVVSLDIKQQFQARKILKQIVVFTDNLDDLD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
S

TT

S
TT


SS


S
SS


 .........150.........160.........170.........180........
Sequence IEEIDLLTEELSTRIILIDCGKSNWLKLVEAIPNSRIYNMNELLVEIT
Predicted secondary structure













SS confidence















































Known secondary structure (DSSP)



S



STT
GGGSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D