Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y58E_

Fold library idPDB HeaderMoleculeTitle
c5y58E_2.80PDB header: rna binding proteinChain: E: PDB Molecule: atp-dependent dna helicase ii subunit 1;


Added to library: Sat Dec 23 08:28:52 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYEL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



S
BGGGTSB


S
S


TT
BTTB
 .........80.........90.........100.........110.........120.........130.........140
Sequence FPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTS

T

TTS








TTS


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VFLFTDIDKPQEAQDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGDSEFDGPSTK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SS
GGGG
TT
SSS


T




S






 .........220.........230.........240.........250.........260.........270.........280
Sequence PIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
GGGTS


GGGTS




TT
S

TT



 .........290.........300.........310.........320.........330.........340.........350
Sequence KFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNIDKSSF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

B
TTT

B
TTS




SS



TT

SS
GGGT

SS


S

 .........360.........370.........380.........390.........400.........410.........420
Sequence IVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTTSTTTSSTTS



SSSSS
S

TTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence KFPSLLSYDDGSEHKLDYDNMKKVTQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENE
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)




S



S
SSTT

TT


GGG


TT





SS
 .........500.........510.........520.........530.........540........
Sequence TPNTKKDRMMREDDSLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDN
Predicted secondary structure

















SS confidence

























































Known secondary structure (DSSP)




TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D