Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y58E_

Fold library idPDB HeaderMoleculeTitle
c5y58E_2.80PDB header: rna binding proteinChain: E: PDB Molecule: atp-dependent dna helicase ii subunit 1;


Added to library: Sat Dec 23 08:28:52 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYEL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



S
BGGGTSB


S
S


TT
BTTB
 .........80.........90.........100.........110.........120.........130.........140
Sequence FPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTS

T

TTS








TTS


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VFLFTDIDKPQEAQDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGDSEFDGPSTK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SS
GGGG
TT
SSS


T




S






 .........220.........230.........240.........250.........260.........270.........280
Sequence PIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
GGGTS


GGGTS




TT
S

TT



 .........290.........300.........310.........320.........330.........340.........350
Sequence KFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNIDKSSF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

B
TTT

B
TTS




SS



TT

SS
GGGT

SS


S

 .........360.........370.........380.........390.........400.........410.........420
Sequence IVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTTSTTTSSTTS



SSSSS
S

TTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence KFPSLLSYDDGSEHKLDYDNMKKVTQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENE
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)




S



S
SSTT

TT


GGG


TT





SS
 .........500.........510.........520.........530.........540........
Sequence TPNTKKDRMMREDDSLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDN
Predicted secondary structure

















SS confidence

























































Known secondary structure (DSSP)




TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D