Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y58D_

Fold library idPDB HeaderMoleculeTitle
c5y58D_2.80PDB header: rna binding proteinChain: D: PDB Molecule: atp-dependent dna helicase ii subunit 2;


Added to library: Sat Dec 23 08:29:27 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SSESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQEIPNVFQIQSF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



TT
T
TTS
S

B
TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LAPVTTTATIGFIKRLKQYCDQHSMIQCLLVVSLDIKQQFQARKILKQIVVFTDNLDDLDITDEEIDLLT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS

T

TTTSS
S
SSS



 .........150.........160.........170.........180.........190.........200.........210
Sequence EELSTRIILIDCGSNWLKLVEAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADILSTQTSNP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





TTSTT
TTS










S

SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SGSMQDENCLCIKVEAFPATKAVSGLNRKTAVEVEDSQKKERYVGVKSIIEYEIHNEGGSSYIPVTISKD
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

GGG
TTSS




SS






SS
SS











GG
 .........290.........300.........310.........320.........330.........340.........350
Sequence SVTKAYRYGADYVVLPSVLVDQTVYESFPGLDLRGFLNREALPRYFLTSESSFITADTRLGCQSDLMAFS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) G



TT


TS




GGGS
GGG

S


TTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence ALVDVMLENRKIAVARYVSKKDSEVNMCALCPVLIEHSNINSEKKFVKSLTLCRLPFAEDERVTDFPKLL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
STT




SSSS


GGG







SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence DRTTTSGVPLKKETDGHQIDELMEQFVDSMDTDELPEIPLGNYYQPIGEVTTDTTLPLPSLENKKDPLRI
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) S
B
SS

B



TTT

TTS



TT
SS

GGGT

S

S






TT
TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence PTVFVYRQQQVLLEWIHQLMINDSREFEIPELPDSLKNKISPYTHKKFDSTKLVEVLGIKKVKRGEQHSR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTS

SS






GGGS


SS



T





SSSB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D