Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y58D_

Fold library idPDB HeaderMoleculeTitle
c5y58D_2.80PDB header: rna binding proteinChain: D: PDB Molecule: atp-dependent dna helicase ii subunit 2;


Added to library: Sat Dec 23 08:29:27 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SSESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQEIPNVFQIQSF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



TT
T
TTS
S

B
TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LAPVTTTATIGFIKRLKQYCDQHSMIQCLLVVSLDIKQQFQARKILKQIVVFTDNLDDLDITDEEIDLLT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS

T

TTTSS
S
SSS



 .........150.........160.........170.........180.........190.........200.........210
Sequence EELSTRIILIDCGSNWLKLVEAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADILSTQTSNP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





TTSTT
TTS










S

SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SGSMQDENCLCIKVEAFPATKAVSGLNRKTAVEVEDSQKKERYVGVKSIIEYEIHNEGGSSYIPVTISKD
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

GGG
TTSS




SS






SS
SS











GG
 .........290.........300.........310.........320.........330.........340.........350
Sequence SVTKAYRYGADYVVLPSVLVDQTVYESFPGLDLRGFLNREALPRYFLTSESSFITADTRLGCQSDLMAFS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) G



TT


TS




GGGS
GGG

S


TTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence ALVDVMLENRKIAVARYVSKKDSEVNMCALCPVLIEHSNINSEKKFVKSLTLCRLPFAEDERVTDFPKLL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
STT




SSSS


GGG







SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence DRTTTSGVPLKKETDGHQIDELMEQFVDSMDTDELPEIPLGNYYQPIGEVTTDTTLPLPSLENKKDPLRI
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) S
B
SS

B



TTT

TTS



TT
SS

GGGT

S

S






TT
TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence PTVFVYRQQQVLLEWIHQLMINDSREFEIPELPDSLKNKISPYTHKKFDSTKLVEVLGIKKVKRGEQHSR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTS

SS






GGGS


SS



T





SSSB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D