Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y2wA_

Fold library idPDB HeaderMoleculeTitle
c5y2wA_2.20PDB header: transcriptionChain: A: PDB Molecule: rubisco operon transcriptional regulator;


Added to library: Sat Dec 30 09:39:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QGRLRLAVITTAKYFIPRLLGEFIQKYPGIEVSLKVTNHEQIRHRMQNNEDDLYIVSEPPEEIDLNYQPF
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
GGGTT
TT
TT

SSS

TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LDNPLVVIARRDHPLAGKSNIPITALNDEAFIMREKGSGTRLAVQNLFHRHYVDVRVRLELGSNEAIKQA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TTSTTTT
SSB
GGGGTT
BB
B

TT
TT


B


B
SS
 .........150.........160.........170.........180.........190.........200........
Sequence IAGGMGISVLSQHTLVSEGARSELTILDIDEFPIKRRWYVANLAGKQLSVITQTFLDYLMAVTKNMPA
Predicted secondary structure


























SS confidence



































































Known secondary structure (DSSP) TTS
BGGGGGS

SS


BTT
SB

TT



TTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D