Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y2vA_

Fold library idPDB HeaderMoleculeTitle
c5y2vA_2.60PDB header: transcriptionChain: A: PDB Molecule: rubisco operon transcriptional regulator;


Added to library: Sat Dec 30 11:11:31 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHMQATLHQLKVFEATARHGSFTRAAEELYITQPTVSSQIKQLSKTVGLPLFEQIGKRLYLTEAGQELLV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

TTS
T
T

TS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TCQDIFQRLDNFAMKVADIKGTKQGRLRLAVITTAKYFIPRLLGEFIQKYPGIEVSLKVTNHEQIRHRMQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT

GGGGGT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NNEDDLYIVSEPPEEIDLNYQPFLDNPLVVIARRDHPLAGKSNIPITALNDEAFIMREKGSGTRLAVQNL
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TT

SSS

TTS
TTSTTTT

SB
GGGGTT

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence FHRHYVDVRVRLELGSNEAIKQAIAGGMGISVLSQHTLVSEGARSELTILDIDEFPIKRRWYVANLAGKQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT


S
TTS
GGGGTT

TT



BTT
STT

 .........290.........300....
Sequence LSVITQTFLDYLMAVTKNMPAPFA
Predicted secondary structure







SS confidence























Known secondary structure (DSSP)

T


S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D