Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y2bA_

Fold library idPDB HeaderMoleculeTitle
c5y2bA_2.20PDB header: hydrolaseChain: A: PDB Molecule: insect group ii chitinase;


Added to library: Sat Jan 20 09:59:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLLNSRYKLVCYYTNWSWYRPGIGKYSPEDIDPSLCTHIVYGFAVLGNDGLMTAHDTWSDYDNRFYERVV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
GGGSS
GGGGS

GGG


GGG

TTS
S
TTSSS
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence EYKRYGIKVSLALGGWNDSAGDKYSKLVNDPAARAKFVQHAVAFLEKYGFDGLDLDWEYPKCWQVDCSKG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGGGGT

TGGGSSST
T
S
S
SSSBTTBTTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PDSDKQGFADLVHELSAVLKPKGLLLSAAVSPNKMVIDAGYDVPVLARLLDWIAVMTYDYHGQWDKKTGH
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTTTT






S



SSSGGGSB


 .........220.........230.........240.........250.........260.........270.........280
Sequence VAPLYYHPDDDTTYFNANYTIHYWMEKGTPASKIVMGMPMYGQSFTIENRGIHGLNIPVSDGGEPGEYTR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) SS
SS

TT
S
SSSSTT

GGGSS
TT

STT
B



TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AKGFLAYYEICDRIRNSGWTVVKDPYQRMGPYAYKGNQWVSFDDVEIIKKKVNFIKSLNLGGGMIWALDL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTS



TT
SS

TT


TT
S
GGG
 .........360.........370.......
Sequence DDYRNRCGQGKHPLLNAIKTELLNPKI
Predicted secondary structure

















SS confidence


























Known secondary structure (DSSP) S
TT
TTSS
SS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D