Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y2bA_

Fold library idPDB HeaderMoleculeTitle
c5y2bA_2.20PDB header: hydrolaseChain: A: PDB Molecule: insect group ii chitinase;


Added to library: Sat Jan 20 09:59:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLLNSRYKLVCYYTNWSWYRPGIGKYSPEDIDPSLCTHIVYGFAVLGNDGLMTAHDTWSDYDNRFYERVV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
GGGSS
GGGGS

GGG


GGG

TTS
S
TTSSS
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence EYKRYGIKVSLALGGWNDSAGDKYSKLVNDPAARAKFVQHAVAFLEKYGFDGLDLDWEYPKCWQVDCSKG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGGGGT

TGGGSSST
T
S
S
SSSBTTBTTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PDSDKQGFADLVHELSAVLKPKGLLLSAAVSPNKMVIDAGYDVPVLARLLDWIAVMTYDYHGQWDKKTGH
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTTTT






S



SSSGGGSB


 .........220.........230.........240.........250.........260.........270.........280
Sequence VAPLYYHPDDDTTYFNANYTIHYWMEKGTPASKIVMGMPMYGQSFTIENRGIHGLNIPVSDGGEPGEYTR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) SS
SS

TT
S
SSSSTT

GGGSS
TT

STT
B



TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AKGFLAYYEICDRIRNSGWTVVKDPYQRMGPYAYKGNQWVSFDDVEIIKKKVNFIKSLNLGGGMIWALDL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTS



TT
SS

TT


TT
S
GGG
 .........360.........370.......
Sequence DDYRNRCGQGKHPLLNAIKTELLNPKI
Predicted secondary structure

















SS confidence


























Known secondary structure (DSSP) S
TT
TTSS
SS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D