Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y00A_

Fold library idPDB HeaderMoleculeTitle
c5y00A_1.60PDB header: fluorescent proteinChain: A: PDB Molecule: green fluorescent protein;


Added to library: Sat Jan 20 10:19:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ASGRALFQYPMTSKIELNGEINGKKFKVAGEGFTPSSGRFNMHAYCTTGDLPMSWVVIASPLFHMFAHYP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

GGGG

SSTT
BTTSSSS
SS
TTGGGTT

GGGSB

 .........80.........90.........100.........110.........120.........130.........140
Sequence EDITHFFQECFPGSYTLDRTLRMEGDGTLTTHHEYSLEDGCVTSKTTLNASGFDPKGATMTKSFVKQLPN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTS

TTTT
TTTTTS

TTST


 .........150.........160.........170.........180.........190.........200.........210
Sequence EVKITPHGPNGIRLTSTVLYLKEDGTIQIGTQDCIVTPVGGRKVTQPKAHFLHTQIIQKKDPNDTRDHIV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTTTTS

SSS





S

SS

SS
 .........220.........
Sequence QTELAVAGNLWHGMDELYK
Predicted secondary structure





SS confidence


















Known secondary structure (DSSP)
SSGGGGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D