Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xzoA_

Fold library idPDB HeaderMoleculeTitle
c5xzoA_1.50PDB header: hydrolaseChain: A: PDB Molecule: beta-xylanase;


Added to library: Sat Jan 20 10:17:05 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence WGLNNAARADGKLWFGTAADIPGLEQDDRYYMKEYNNTHDFGGTTPANIMKFMFTEPEQNVFNFTGAQEF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TT
S
TTTGGGG
T
TTT
SSSTTS
SBTTB


 .........80.........90.........100.........110.........120.........130.........140
Sequence LDIAFASHKLVRCHNLIWQSELPTWVTNPTTNWTNETLSKVLQNHVYTLVSHFGDQCYSWDVVNEALSDD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT

SSS

S
SS


GGG
S

B
ST
 .........150.........160.........170.........180.........190.........200.........210
Sequence PAGSYQNNIWFDTIGPEYVAMAFEYAEKAVKDHKLNVKLYYNDYNIEYPGPKSTAAQNIVKELKARNIQI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTSB



TTT


SS
SSSSTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence DGVGLESHFIAGETPSQATQITNMADFTSLDIDVAVTELDVRLYLPPNATSEAQQVADYYATVAACAATE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TTTS

TTT
SS


T
 .........290.........300.........310.........320.........330.....
Sequence RCIGITVWDFDDTYSWVPSTFAGQGYADLFFQPDGPNTPLVKKAAYDGCLQALQH
Predicted secondary structure







































SS confidence






















































Known secondary structure (DSSP) TS
SBGGG
SSTT

SS
TT
TTS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D