Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xu1M_

Fold library idPDB HeaderMoleculeTitle
c5xu1M_3.30PDB header: transport proteinChain: M: PDB Molecule: abc transporter permeae;


Added to library: Sat Jan 27 09:23:17 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QNLKFAFSSIMAHKMRSLLTMIGIIIGVSSVVVIMALGDSLSRQVNKDMTKSQKNISVFFSPKKPPKPQE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TGGG
S






 .........80.........90.........100.........110.........120.........130.........140
Sequence SWVQEAAKLKGVDSYYVTNSTNAILTYQDKKVENANLTGGNRTYMDAVKNEIIAGRSLREQDFKEFASVI
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) TTSTT



TT
S

STT




TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence LLDEELSISLFESPQEAINKVVEVNGFSYRVIGVYTSPEAKRSKIYGFGGLPITTNISLAANFNIDEIAS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SSTT
SSS

TTTTT
S


SS

S
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence IVFRVNDTSLTPTLGPELARKMTELAGLQQGEYQVADESVVFAEIQQSFSFMTTIISSIAGISLFVGGTG
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
SSGGG


SS


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence VMNIMLVSVTERTREIGLRKALGATRANILIQFLIESMILTLLGGLIGLTIASGLTALAGLLLQGLIEGI
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TT

TTTTTT

S
 .........360.........370.........380.........390
Sequence EVGVSIPVALFSLAVSASVGMIFGVLPANKASKLDPIEAL
Predicted secondary structure




SS confidence







































Known secondary structure (DSSP)




T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D