Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xu1A_

Fold library idPDB HeaderMoleculeTitle
c5xu1A_3.30PDB header: transport proteinChain: A: PDB Molecule: abc transporter atp-binding protein;


Added to library: Sat Jan 27 09:21:23 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KQLISLKNIFRSYELQVLKNINLEVNEGEFVAIMGPSGSGKSTLMNTIGMLDTPTSGEYYLEGQEVAGLG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



TT

STTSSTTSS

STT
TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence EKQLAKVRNQQIGFVFQQFFLLSKLNALQNVELPLIYAGVSSSKRRKLAEEYLDKVELTERSHHLPSELS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT



TTS
TT

TT

S
TT

GGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GGQKQRVAIARALVNNPSIILADEPTGALDTKTGNQIMQLLVDLNKEGKTIIMVTHEPEIAAYAKRQIVI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT

SSTTSSS
T

S
TTSS
 .........220.
Sequence RDGVISSDSAQ
Predicted secondary structure




SS confidence










Known secondary structure (DSSP) TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D