Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xu0B_

Fold library idPDB HeaderMoleculeTitle
c5xu0B_2.95PDB header: transport proteinChain: B: PDB Molecule: membrane-fusion protein;


Added to library: Sat Jan 27 08:40:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVLLSGTVTAKNEQYVYFDASKGDLDEILVSVGDKVSEGQALVKYSSSEAQAAYDSASRAVARADRHINE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

S


GGG





SS

TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence LNQARNEAASANSVASIDAQLGDARDARADAAAQLSKAQSQLDAXTVLSTLEGTVVEVNSNVSKSPTGAS
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TTT



TT
SSS




SS

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QVXVHIVSNENLQVKGELSEYNLANLSVGQEVSFTSKVYPDKKWTGKLSYISDYPKNNNTGSKYPYTIDV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SSS



TT
TT
SS








 .........220.........230.
Sequence TGEVGDLKQGFSVNXEVKSKT
Predicted secondary structure











SS confidence




















Known secondary structure (DSSP) S


S

TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D