Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xtwH_

Fold library idPDB HeaderMoleculeTitle
c5xtwH_3.20PDB header: sugar binding proteinChain: H: PDB Molecule: macrophage mannose receptor 1;


Added to library: Sat Dec 30 08:42:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYAC
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


TTTTTTS

TT
GGG
SSS
TTT


SSSSSS


 .........80.........90.........100.........110.........120.........130.........140
Sequence DSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYGTTDNLCSRGYEAMYTLLG
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TT
GGG

STTBTTSS


GGG

B
S

SGGGB
TTSS
BGGGG




B
BST
 .........150.........160.........170.........180.........190.........200.........210
Sequence NANGATCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDTDKLFGYCPLKFEGSESLWNKDPLTSVSYQ
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) TTTT
B

SSTTSS
B
TT
SS


SSSB


SS

TTGGGG
TTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence INSKSALTWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRYL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTT




STTT

S



TTB

TT




B
 .........290.........300.........310.........320.........330.........340.........350
Sequence NWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKWPYAGHCYKIHRDEKKIQRDALTTCRKEG
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
B
TT
S
S
TT

GGGTT
TT



TT
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence GDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHEQEDCVVMKG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S



STS


TT

SSSTTB
TTS






BBTT







S
 .........430.........440.
Sequence KDGYWADRGCEWPLGYICKMK
Predicted secondary structure











SS confidence




















Known secondary structure (DSSP) TT


S
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D