Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xspB_

Fold library idPDB HeaderMoleculeTitle
c5xspB_2.15PDB header: hydrolaseChain: B: PDB Molecule: phosphodiesterase acting on cyclic dinucleotides;


Added to library: Sat Feb 3 08:24:05 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEI
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS
BSS

TT



GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence DKKPELRERFITSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYM
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT
TT


TTS


GGGBS

S
S


SS

SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence EPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQH
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TTSS
TTS

TT


TTTTSS

TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence FLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T


TT

TTS

TT
B

TTSTT
STT
 .........290.........300.........310.........320.........330.
Sequence ISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQL
Predicted secondary structure


















SS confidence


















































Known secondary structure (DSSP) SSSS
TTT
TTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D