Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xnpB_

Fold library idPDB HeaderMoleculeTitle
c5xnpB_3.73PDB header: membrane protein/hydrolaseChain: B: PDB Molecule: leucine-rich repeat and fibronectin type-iii domain-


Added to library: Sat Jan 27 09:09:07 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PGDPQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLADNFVTNIKRKDFANMTSLVDLTLS
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)







TTS
SSSS
TTS

SS

S


TT

S




TTTTTT
SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence RNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVFALEELD
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) S




TTTTTT
TT



SS



SSTTSS

S
S

S




TTTTTT



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLA
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

SS

S


TT
TT



SS





TTSTTS

S



SS

S




SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence TSGIISPSTFALSFGGNPLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHT
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
TT




SS
TTS
SGGGTS






SGGGTT
BGGGS
GGG



 .........290.........300.........310.........320.........330.........340.........350
Sequence HEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIASNPA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


TTS


B
S


TTSS


SSSS

SSS

SS

GGG

SS
 .........360.
Sequence GEATQIVDLHI
Predicted secondary structure
SS confidence










Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D