Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xnpB_

Fold library idPDB HeaderMoleculeTitle
c5xnpB_3.73PDB header: membrane protein/hydrolaseChain: B: PDB Molecule: leucine-rich repeat and fibronectin type-iii domain-


Added to library: Sat Jan 27 09:09:07 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PGDPQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLADNFVTNIKRKDFANMTSLVDLTLS
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)







TTS
SSSS
TTS

SS

S


TT

S




TTTTTT
SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence RNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVFALEELD
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) S




TTTTTT
TT



SS



SSTTSS

S
S

S




TTTTTT



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLA
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

SS

S


TT
TT



SS





TTSTTS

S



SS

S




SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence TSGIISPSTFALSFGGNPLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHT
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
TT




SS
TTS
SGGGTS






SGGGTT
BGGGS
GGG



 .........290.........300.........310.........320.........330.........340.........350
Sequence HEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIASNPA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


TTS


B
S


TTSS


SSSS

SSS

SS

GGG

SS
 .........360.
Sequence GEATQIVDLHI
Predicted secondary structure
SS confidence










Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D