Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xj0D_

Fold library idPDB HeaderMoleculeTitle
c5xj0D_4.00PDB header: transferase/transcriptionChain: D: PDB Molecule: dna-directed rna polymerase subunit beta';


Added to library: Sat Dec 23 09:38:28 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDKSIVRRYRMGHIELAT
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)











SS

B
SSSSSB
TT
TT


S


TTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence PAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SSS
SSSSTTTSS

S




SSSS

TT

T



 .........150.........160.........170.........180.........190.........200.........210
Sequence TYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYK
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

TT

SSTT

S


TT

SBTTB


S
S
SB





B
B

SSS



TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence PGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT






S











SS
SSSS


SSS


SS

TTTT







 .........290.........300.........310.........320.........330.........340.........350
Sequence KGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S




TT


TT





TT

S
SS



TT



SSSTT
B
 .........360.........370.........380.........390.........400.........410.........420
Sequence IAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


S



BS





SS



TT
SS
S

BTTTTB


S

SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence ESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) S





SS

SS
TTTTTS

GGGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence PVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

GGGS

SSS

T



SSSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence GAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S


SSSS

S



TTGGGSSSSTT



SS
TTS
TTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence LKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) STT
SSTSSGGG

TT


SS

SGGGSSSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence LHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
GGGTTTTT

TTT



STSBGGG

B
SSSSSBSS


S



 .........780.........790.........800.........810.........820.........830.........840
Sequence EKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVR
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)



S



SS
STTTS

SSS

SS


S
TTSS
TTS
 .........850.........860.........870.........880.........890.........900.........910
Sequence YMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSS
SS
T

TTS



S
 .........920.........930.........940.........950.........960.........970.........980
Sequence GFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) T




GGGS


TTTSS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence FKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TT
SSSS

T




B
SSS
B
SS




SSS


 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence RKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SSSSTT

S






SB


SSSS


B

TT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence VLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SS

SS

TT
B

TTS
S
STT

STTSTTTS
S
SSSSS


T
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence GEAVGIVAAQSIGEPGTQLTMGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T

GGGGG



TT


SS


B
SS



SS


SS
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence KLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TT

BSS
TT

TT
B
BSS



TT



 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence QMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNT
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTS
SSS
SS

SSS










S
TTSS
 .........1410.........1420.........1430.........1440.........1450.........1460..
Sequence THVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA
Predicted secondary structure


































SS confidence





























































Known secondary structure (DSSP) TT


STT


SSGGG
S




TTTTTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D