Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xi0B_

Fold library idPDB HeaderMoleculeTitle
c5xi0B_2.09PDB header: oxidoreductaseChain: B: PDB Molecule: enoyl-[acyl-carrier-protein] reductase [nadh];


Added to library: Sat May 19 08:38:25 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIIKPRIRGFICTTTHPVGCEQNVKEQIALTKAQGPIANAPKRVLVVGSSSGYGLSSRITAAFGGGASTI
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)





TT



TT


TT

SS
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence GVFFEKAGTEKKPGTAGWYNSAAFDKFAKEEGLYSKSLNGDAFSNEAKQKTIDLIKEDLGQIDMVVYSLA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)





SSS


TT

S
TTSTTT
S


 .........150.........160.........170.........180.........190.........200.........210
Sequence SPVRKMPETGEVIRSSLKPIGETYTATAVDTNKDAIIEASVEPATEQEIKDTVTVMGGEDWELWINALSE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
S
TTT






SSS
TTTT



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AGVLADGCKTVAYSYIGTELTWPIYWDGALGQAKMDLDRAATALNEKLSATGGTANVAVLKSVVTQASSA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT



GGGTSSTTT





TTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IPVMPLYIAMVFKKMREEGVHEGCQEQILRMFSQRLYKADGSAAEVDEKNRLRLDDWELREDIQQHCRDL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) STTTT



TTS
SS






TTS


TTTT
 .........360.........370.........380.........390.........400
Sequence WPQVTTENLKDLTDYVEYKEEFLKLFGFGVDGVDYDADVNPEVNFDVADI
Predicted secondary structure
























SS confidence

















































Known secondary structure (DSSP) GGG

TTTS
TTT
S
TT

TTS







S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D