Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xgxB_

Fold library idPDB HeaderMoleculeTitle
c5xgxB_2.33PDB header: hydrolaseChain: B: PDB Molecule: isoaspartyl dipeptidase;


Added to library: Sat Mar 3 08:53:10 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TMLILLCNVNIYAPNPLGIKDVLIAGNKIAAIYDHGQGEITIPKQWPVKVINFDGAILTPGFIDSHAHIT
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

SSSTT


S




TTS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GGGGQAGFATQVPPVGLTEFTHAGVTTVVGLLGTDDTTRSTENLLSRVYGLREEGLSAYCWTGGYHFPLT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

B
TT
GGGB




TTT


S

SSS
T
S
SSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence TITGSAKSDIAFLEPVIGIGEFAISDHRSSQPTFEEVIRLASETHVAGLITGKAGVIHFHLGDGERRLEL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
SSSS
TTSSTTS



SS


S
TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IERAIRETELPARVFNPTHVNRNKPLFEDSCKLLSKGCHIDLTAFPAGTAQPGWEACDAIEMAVERQLPL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S


GGG
TTSSGGGT




TT

TTS

TT

G
 .........290.........300.........310.........320.........330.........340.........350
Sequence EQITLSSDGGGCLPCMDFGRASTLGETLVATLNKGLSLETVLPMLTSNVANILRFKNKGQIAVGFDADLL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) GG

BT





TTTT

GGGGTTT
TTSSS
STTSB

 .........360.........370.........380.
Sequence VMNEKYEITDVMAQGVWHKQNNQTMIKGTFE
Predicted secondary structure












SS confidence






























Known secondary structure (DSSP)
TT

TTTT



TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D