Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xgdA_

Fold library idPDB HeaderMoleculeTitle
c5xgdA_2.80PDB header: transcriptionChain: A: PDB Molecule: uncharacterized protein pa0861;


Added to library: Sat Dec 23 09:54:30 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DAERERAQITLASIGDGVITADTQGGISYLNPAAEQMTNWTLDKARGLPLASLFRIVDESEQILSGEIDG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


SSTTSB
T

BTSBGGGT
B





GGGSSS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence GREHSKLVLRHDGSSVPVTLVGAPIHRGAEITGVVLVLHDMTRERQYMARLSWQATHDALTGLTNRREFE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SS

B
SSS


SSS
TTGGGG
B
TTT
SB
 .........150.........160.........170.........180.........190.........200.........210
Sequence YRLQIALERLERNSGRHALMFLDLDQFKLVNDTCGHAAGDELLRQVCTLLQQGLREGDTLARLGGDEFGI
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
SSS

S
TT
S
TT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LLENCPAEKAVEIADHLRKTIQDLHFTWSGQPFNCTVSVGLVHLLPGISTLEEALRSADMACYMAKEKGR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT

T
TT


TTTS
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence NRVQVFHQDDVELSMRFGEMTWVQRIHLALEEDRFSLYAQPIVPLGEGAEEGLHVELLLRLRDEGGRLVP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S


TTTTTTT

STT


S
SSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence PLSFIPAAERYGLMTLIDRWVVENAFRTLVERAQDPRAEPIGTCAINLSGATIGDESFLQFLTELFARYR
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) GGGTTT
T
TTS



T
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence IPPQTICFEVTETVAVANLASAIRFINELKDTGCRFSLDDFCAGMSSFIYLKHLPVDYLKIDGSFVKDML
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

GGGTT


S


S
TTT
 .........500.........510.........520.........530.........540........
Sequence EDPIDRAMVQVINHIGHVMGKRTIAEFVETVEVMEALREIGIDYAQGLAIGAPLPFSR
Predicted secondary structure





















SS confidence

























































Known secondary structure (DSSP) T
TT




ST
S
STTT






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D