Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xg0A_

Fold library idPDB HeaderMoleculeTitle
c5xg0A_1.58PDB header: hydrolaseChain: A: PDB Molecule: poly(ethylene terephthalate) hydrolase;


Added to library: Sat Dec 23 08:31:17 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AMNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWW
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)


TT

SS


SSS
SS

SS
SSSSS

SS


TT

GGGTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GPRLASHGFVVITIDTNSTLDQPSSRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGWSMGGGGSL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

SSTT

T
TTSTTTT
BT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ISAANNPSLKAAAPQAPWDSSTNFSSVTVPTLIFACENDSIAPVNSSALPIYDSMSRNAKQFLEINGGSH
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT



BS


S



TT

S
TT
SSS
TTTTT

SS
TT

T
 .........220.........230.........240.........250.........260...
Sequence SCANSGNSNQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTRVSDFRTANCS
Predicted secondary structure
























SS confidence




















































Known secondary structure (DSSP) TTTSTT
TTS

GGGS



TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D