Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xg0A_

Fold library idPDB HeaderMoleculeTitle
c5xg0A_1.58PDB header: hydrolaseChain: A: PDB Molecule: poly(ethylene terephthalate) hydrolase;


Added to library: Sat Dec 23 08:31:17 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AMNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWW
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)


TT

SS


SSS
SS

SS
SSSSS

SS


TT

GGGTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GPRLASHGFVVITIDTNSTLDQPSSRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGWSMGGGGSL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

SSTT

T
TTSTTTT
BT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ISAANNPSLKAAAPQAPWDSSTNFSSVTVPTLIFACENDSIAPVNSSALPIYDSMSRNAKQFLEINGGSH
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT



BS


S



TT

S
TT
SSS
TTTTT

SS
TT

T
 .........220.........230.........240.........250.........260...
Sequence SCANSGNSNQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTRVSDFRTANCS
Predicted secondary structure
























SS confidence




















































Known secondary structure (DSSP) TTTSTT
TTS

GGGS



TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D