Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xftA_

Fold library idPDB HeaderMoleculeTitle
c5xftA_2.46PDB header: oxidoreductaseChain: A: PDB Molecule: dehydroascorbate reductase;


Added to library: Sat Dec 30 08:31:18 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNIVTTIYVKGDPAKNKLLDCPFCHRVLLAYEAKKLPYKMEYIDFDNKPAWLLEASGGKVPVIKEGPDAP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

SSGGGT


TT


TTS

TT
S

STTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YMPDSDVIVVHLEKQHPEPSLQSSVPAEIGAKLFPNFRAILIGPAAEVADKVAALEEQLAGMDDYLRQHE
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)



SS




S
TTTTTTS
GGGTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AQGPLFGGQHLNGTDCSLAPKLYHAVVALKHFKGWELPARFTALHKYLAALKALPEWQHVDYGTEAIIAG
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
SBTTBTS






TT

T


 .....
Sequence WERHI
Predicted secondary structure

SS confidence




Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D