Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xfmD_

Fold library idPDB HeaderMoleculeTitle
c5xfmD_2.30PDB header: hydrolaseChain: D: PDB Molecule: alpha-glucosidase;


Added to library: Sat Mar 3 08:36:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LQDVVVKGPDEKLQLAVFVQNETKPCYSVSYNGKTMLEKSPLGMNTNIGDFTKNLKLTGHSVDKIDTVYQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

S
TTS

TT
SS
TT

TTSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence QTRIKVSNVHYRANELTCHLENEQGQKLGVIFRVSDNDVAFRYTLPHQGGKASVTVKEEQTGFRFPEQTT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SSSS
S
TT


SS
SBTTBS



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TFLCPQSDAMIGWKRTKPSYEEEYKADAPMSDRSQYGHGYTFPCLFRIGNDGWVLVSETGVDSRYCGSRL
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
B


TT
SGGG


SS



TT


SSSS
B
S
TTS



TTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence SDVSEGNLYTVAFPMAEENNGNGTVAPAFALPGATPWRTITVGDHLKPIVETTVPWDVVSPLYETKHDYR
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


BTTT


TTGGGG
S
SS
SS

SSS

T


SS

SS


 .........290.........300.........310.........320.........330.........340.........350
Sequence FGRGTWSWILWQDGSINYDDQVRYIDFASAMGYEYALIDNWWDTRIGHQRMKSLVEYARDKGVELFLWYS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TGGGG
ST
S
TTT
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SSGYWNDIEQGPVNRMDNAIIRKREMKWLQSLGVKGIKVDFFGGDKQETMRLYEDILSDADDHGLMVIFH
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

SSSS


SSS
SSSSST





SSTT

 .........430.........440.........450.........460.........470.........480.........490
Sequence GCTLPRGWERMYPNYVGSEAVLASENMVFNQHFCDEEAFNTCLHPFIRNTVGSMEFGGCLLNKRLNRNND
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) S



SS
TT

S

T
TTTTTTTTTTS
B







SBSSTTSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence GGTTRRTTDVFQLATTVLLQNPVQNFALAPNNLKDVPAVCMDFMKRVPTTWDETRFVDGYPGKYVVLARR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SS
B

S
S

S



TTS





STTT
 .........570.........580.........590.........600.........610.........620.........
Sequence QGDTWYLAAVNAGKEPLKLKLDLEMFAGKTVALYKDDKKGEPELTSLKVKENGKVQLEIRPQGGILCIK
Predicted secondary structure

































SS confidence




































































Known secondary structure (DSSP) TT
SSS

GGGTT

TTS


TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D