Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xfmD_

Fold library idPDB HeaderMoleculeTitle
c5xfmD_2.30PDB header: hydrolaseChain: D: PDB Molecule: alpha-glucosidase;


Added to library: Sat Mar 3 08:36:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LQDVVVKGPDEKLQLAVFVQNETKPCYSVSYNGKTMLEKSPLGMNTNIGDFTKNLKLTGHSVDKIDTVYQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

S
TTS

TT
SS
TT

TTSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence QTRIKVSNVHYRANELTCHLENEQGQKLGVIFRVSDNDVAFRYTLPHQGGKASVTVKEEQTGFRFPEQTT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SSSS
S
TT


SS
SBTTBS



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TFLCPQSDAMIGWKRTKPSYEEEYKADAPMSDRSQYGHGYTFPCLFRIGNDGWVLVSETGVDSRYCGSRL
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
B


TT
SGGG


SS



TT


SSSS
B
S
TTS



TTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence SDVSEGNLYTVAFPMAEENNGNGTVAPAFALPGATPWRTITVGDHLKPIVETTVPWDVVSPLYETKHDYR
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


BTTT


TTGGGG
S
SS
SS

SSS

T


SS

SS


 .........290.........300.........310.........320.........330.........340.........350
Sequence FGRGTWSWILWQDGSINYDDQVRYIDFASAMGYEYALIDNWWDTRIGHQRMKSLVEYARDKGVELFLWYS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TGGGG
ST
S
TTT
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SSGYWNDIEQGPVNRMDNAIIRKREMKWLQSLGVKGIKVDFFGGDKQETMRLYEDILSDADDHGLMVIFH
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

SSSS


SSS
SSSSST





SSTT

 .........430.........440.........450.........460.........470.........480.........490
Sequence GCTLPRGWERMYPNYVGSEAVLASENMVFNQHFCDEEAFNTCLHPFIRNTVGSMEFGGCLLNKRLNRNND
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) S



SS
TT

S

T
TTTTTTTTTTS
B







SBSSTTSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence GGTTRRTTDVFQLATTVLLQNPVQNFALAPNNLKDVPAVCMDFMKRVPTTWDETRFVDGYPGKYVVLARR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SS
B

S
S

S



TTS





STTT
 .........570.........580.........590.........600.........610.........620.........
Sequence QGDTWYLAAVNAGKEPLKLKLDLEMFAGKTVALYKDDKKGEPELTSLKVKENGKVQLEIRPQGGILCIK
Predicted secondary structure

































SS confidence




































































Known secondary structure (DSSP) TT
SSS

GGGTT

TTS


TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D