Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xccA_

Fold library idPDB HeaderMoleculeTitle
c5xccA_2.48PDB header: structural proteinChain: A: PDB Molecule: probable surface protein;


Added to library: Sat Mar 3 08:44:46 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTPSISKDAPIKGSITISKKGATFTAYKLLDAIKSGDAYEYSVNSDLKDFFNNSNYGSYSQESIQKLNGE
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)





TT

S

TT


SSS
GGGGGGTT
GGGTT

STTSSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence QVKEFAINLHKYILENKKSGQELKDGQKNTVDLGYYLVTETSSDSEGAAVASTPIIVSVPQVSGDSWNYD
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT



SSSS

S

SSS





STTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VTINPKDNTPILEKNIVKENQRVKTSSENIGDVVKYEVKASIPVYQKNAQNIMYKFTDTMSKGLTYDEKT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)







TTS

TTS





SS

S


TT
TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GFKVTSGDKVFAKDTDYTVDVKKQEDGSTVITINFVYENIKAYAETGITLNYQATLNKDAVISNKENLGN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TT

BTTT
TTS

GGGTTT

TTS
B
SS



 .........290.........300.........310.........320.........330.........340.........350
Sequence TNNIQLDYTNNPHVKDSYKKLTDKVTTYTFGFGITKVDSELNSKLLQGAEFSVKDAGGKIVAKYTYDEKG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S
TTSTT
BSS
TTSB

S

TTS
B



SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence QVVYLSGNGVTNSKGITTFLGLKEGKYFITEEVAPSGYSLLKNPVEVTITANKDESGNYTGAATIEISNG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


S


TTS
S

TTB


SS

TTS
SS
 .........430.........440.........450....
Sequence NKAGQIINDISEKDGNILFNVQIENHAGFSLPST
Predicted secondary structure




















SS confidence

































Known secondary structure (DSSP)
TT



TTS

B







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D