Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xccA_

Fold library idPDB HeaderMoleculeTitle
c5xccA_2.48PDB header: structural proteinChain: A: PDB Molecule: probable surface protein;


Added to library: Sat Mar 3 08:44:46 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTPSISKDAPIKGSITISKKGATFTAYKLLDAIKSGDAYEYSVNSDLKDFFNNSNYGSYSQESIQKLNGE
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)





TT

S

TT


SSS
GGGGGGTT
GGGTT

STTSSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence QVKEFAINLHKYILENKKSGQELKDGQKNTVDLGYYLVTETSSDSEGAAVASTPIIVSVPQVSGDSWNYD
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT



SSSS

S

SSS





STTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VTINPKDNTPILEKNIVKENQRVKTSSENIGDVVKYEVKASIPVYQKNAQNIMYKFTDTMSKGLTYDEKT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)







TTS

TTS





SS

S


TT
TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GFKVTSGDKVFAKDTDYTVDVKKQEDGSTVITINFVYENIKAYAETGITLNYQATLNKDAVISNKENLGN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TT

BTTT
TTS

GGGTTT

TTS
B
SS



 .........290.........300.........310.........320.........330.........340.........350
Sequence TNNIQLDYTNNPHVKDSYKKLTDKVTTYTFGFGITKVDSELNSKLLQGAEFSVKDAGGKIVAKYTYDEKG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S
TTSTT
BSS
TTSB

S

TTS
B



SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence QVVYLSGNGVTNSKGITTFLGLKEGKYFITEEVAPSGYSLLKNPVEVTITANKDESGNYTGAATIEISNG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


S


TTS
S

TTB


SS

TTS
SS
 .........430.........440.........450....
Sequence NKAGQIINDISEKDGNILFNVQIENHAGFSLPST
Predicted secondary structure




















SS confidence

































Known secondary structure (DSSP)
TT



TTS

B







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D