Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xbkB_

Fold library idPDB HeaderMoleculeTitle
c5xbkB_3.22PDB header: protein transportChain: B: PDB Molecule: importin-4;


Added to library: Sat Feb 17 08:24:22 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PYMESVFEEVFKLLECPHLNVRKAAHEALGQFCCALHKACQSCPSEPNTAALQAALARVVPSYMQAVNRE
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)

GGGGG
S
TTS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RERQVVMAVLEALTGVLRSCGTLTLKPPGRLAELCGVLKAVLQRKTACQEYDAMLLEHAGEAIPALAAAA
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)

T

STTTT
SS


TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GGDSFAPFFAGFLPLLVCKTKQGCTVAEKSFAVGTLAETIQGLGAASAQFVSRLLPVLLSTAQEADPEVR
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
STTTGGGSTTS
GGGGGGGTT
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SNAIFGMGVLAEHGGHPAQEHFPKLLGLLFPLLARERHDRVRDNICGALARLLMASPTRKPEPQVLAALL
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) STTTT

SSSS



 .........290.........300.........310.........320.........330.........340.........350
Sequence HALPLKEDLEEWVTIGRLFSFLYQSSPDQVIDVAPELLRICSLILADNKIPPDTKAALLLLLTFLAKQHT
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
S
SS
STT

TTSGGGSS
SSS
S
 .........360.........370...
Sequence DSFQAALGSLPVDKAQELQAVLG
Predicted secondary structure


SS confidence






















Known secondary structure (DSSP) TTS
TTGGGTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D