Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5xaqB_

Fold library idPDB HeaderMoleculeTitle
c5xaqB_1.86PDB header: hydrolaseChain: B: PDB Molecule: probable d-tyrosyl-trna(tyr) deacylase 2;


Added to library: Sat Feb 17 08:24:26 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AQARALLQQCLHARLQVRPADGDAAAQWVEIRRGLVIYVCFFKGADTDLLPKMVNTLLNVKLSETETGKH
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S

BTTB

SSBTT

GGGS


TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VSILDLPGDVLIIPQATLGGRVKGRSMQYHSNSGKEEGSELYSQFVSLCEKAVANNTKSVEAGVAVAHGT
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
TTTTT

GGGG
TT
TTB

T
TT



 .........150.........160.
Sequence YGNRQVLKLDTNGPYTHLIEF
Predicted secondary structure






SS confidence




















Known secondary structure (DSSP) TTS



S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D