Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x89A_

Fold library idPDB HeaderMoleculeTitle
c5x89A_1.53PDB header: hydrolaseChain: A: PDB Molecule: enda-like protein,trna-splicing endonuclease;


Added to library: Sat Jan 27 08:19:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AAKGELVGSKVLVRNDRDANRLYSSMYGKPSRRGLQLWPEEALFLCEIGRLEVRSGNVRISPEELMDRFV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT

TTT
SB

TTS
TTSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence EEDPRFPVRYAVYADLRRRGWKPKPGRKFGTEFRAFRGEDERIAVKVLQEELDEFTAQDILEWLKLVEGT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTTT
SSGGGSSTTTTTT

TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EFELVVAIVDNDYDLNYYVFSELVLGGELPRAKVFEGGSLVSKDYEDLKRRYFGTEHGNVLFLDPFETVY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S

TTS







TT
SS
TT
STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LTEKGEIDPETPEGEPMSVEELLSFFERRRPGFRAGYVVYRDLTERGYVVKSGFKYGGRFRVYEEDPDRE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTS

TTS
B

TSSTTTT

GGGTSSSS
TTTS
 .........290.........300.........310.........320.........330.......
Sequence HSKYVVRVVEPDTELSTRDVLRATRLAHSVRKDFVLAVVEDVEEPRIEYVMWRWKRL
Predicted secondary structure

















SS confidence
























































Known secondary structure (DSSP)



TT

TT
TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D