Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x7uA_

Fold library idPDB HeaderMoleculeTitle
c5x7uA_2.50PDB header: hydrolaseChain: A: PDB Molecule: trehalose synthase;


Added to library: Sat Mar 3 08:49:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DPTWYKDAIIYEVGVRCFFDSNNDGSGDIPGLTAKLDYIESLGVTAIWLLPFYASPLKDGGYDISDYRSL
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
TTGGGG




SSSSSS

TT







TTTT
S
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence HPDFGTIEDFKVFLDEAHRRGIRVITELVLNHTSDQHQWFREARSNPNSPYRDYYVWSDTDDKYKDARII
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
GGG

TT

TTB

TTSTT
TTSTTGGGB
SSTTTTTT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FIDTERSNWTWDQEAGKYYWHRFFSHQPDLNYDNPKVQQEILDIVGYWLDMGVDGLRLDAVPYLYEREGT
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) STTT
S
SGGGT
SS
TTS
BB
TTSTT

TTGGGS


TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence NCENLPETHEFLKKLRKFVDDNWPNRMLLAEANQWPEDVVAYFGNGDECHMAYHFPIMPRMYMALRREDR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SSS
STT



S
GGGTTTTS
S
TTT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence HPITEILRRTPPIPETCQWALFLRNHDELTLEMVTDEERDYMYHEYAKDPRMRLNLGIRRRLAPLLDNSE
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TS



TT
S

SS

TTS


SGGGB
SS


TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence RRIQLMHLLLFTLPGTPIIYYGDEIGMGDNVYLGDRDGVRTPMQWSGDRNAGFSRANPQALYLPPIRDPV
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) SSSTTGGGT



TTSSTTGGG






SSGGGGS

S
GGGSSS



STT
 .........430.........440.........450.........460.........470.........480.........490
Sequence FTYEAVNVEAQEQVPTSLLNWMKRTIQIRKKYPVFGRGSIRFLQPSNRAVLAYIRQYQDTTILCACNLSR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T
TTTS
TSTTST
T



S
TTTT
SS
 .........500.........510.........520.........530.........540......
Sequence FCQAAELDLSDFKGLYPVELYGKTVFPQIGELPYLLTFGPHVFYWFELKPQEQLPH
Predicted secondary structure






























SS confidence























































Known secondary structure (DSSP) S


GGGTT
TTTT




SS

TT

GGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D