Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x7uA_

Fold library idPDB HeaderMoleculeTitle
c5x7uA_2.50PDB header: hydrolaseChain: A: PDB Molecule: trehalose synthase;


Added to library: Sat Mar 3 08:49:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DPTWYKDAIIYEVGVRCFFDSNNDGSGDIPGLTAKLDYIESLGVTAIWLLPFYASPLKDGGYDISDYRSL
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
TTGGGG




SSSSSS

TT







TTTT
S
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence HPDFGTIEDFKVFLDEAHRRGIRVITELVLNHTSDQHQWFREARSNPNSPYRDYYVWSDTDDKYKDARII
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
GGG

TT

TTB

TTSTT
TTSTTGGGB
SSTTTTTT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FIDTERSNWTWDQEAGKYYWHRFFSHQPDLNYDNPKVQQEILDIVGYWLDMGVDGLRLDAVPYLYEREGT
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) STTT
S
SGGGT
SS
TTS
BB
TTSTT

TTGGGS


TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence NCENLPETHEFLKKLRKFVDDNWPNRMLLAEANQWPEDVVAYFGNGDECHMAYHFPIMPRMYMALRREDR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SSS
STT



S
GGGTTTTS
S
TTT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence HPITEILRRTPPIPETCQWALFLRNHDELTLEMVTDEERDYMYHEYAKDPRMRLNLGIRRRLAPLLDNSE
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TS



TT
S

SS

TTS


SGGGB
SS


TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence RRIQLMHLLLFTLPGTPIIYYGDEIGMGDNVYLGDRDGVRTPMQWSGDRNAGFSRANPQALYLPPIRDPV
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) SSSTTGGGT



TTSSTTGGG






SSGGGGS

S
GGGSSS



STT
 .........430.........440.........450.........460.........470.........480.........490
Sequence FTYEAVNVEAQEQVPTSLLNWMKRTIQIRKKYPVFGRGSIRFLQPSNRAVLAYIRQYQDTTILCACNLSR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T
TTTS
TSTTST
T



S
TTTT
SS
 .........500.........510.........520.........530.........540......
Sequence FCQAAELDLSDFKGLYPVELYGKTVFPQIGELPYLLTFGPHVFYWFELKPQEQLPH
Predicted secondary structure






























SS confidence























































Known secondary structure (DSSP) S


GGGTT
TTTT




SS

TT

GGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D