Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x7nA_

Fold library idPDB HeaderMoleculeTitle
c5x7nA_1.72PDB header: lyaseChain: A: PDB Molecule: diaminopimelate decarboxylase;


Added to library: Sat Jan 13 08:23:54 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TVENFNELPAHVWPRNAVRQEDGVVTVAGVPLPDLAEEYGTPLFVVDEDDFRSRCRDMATAFGGPGNVHY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
T


TTTS
TT
TTSBTT
SSTTSGGGB
 .........80.........90.........100.........110.........120.........130.........140
Sequence ASKAFLTKTIARWVDEEGLALDIASINELGIALAAGFPASRITAHGNNKGVEFLRALVQNGVGHVVLDSA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) GGG


TT

STT

GGG

TT

T
S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence QELELLDYVAAGEGKIQDVLIRVKPGIEAHTHEFIATSHEDQKFGFSLASGSAFEAAKAANNAENLNLVG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T


S
SS

S


SSSSSTTS
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LHCHVGSQVFDAEGFKLAAERVLGLYSQIHSELGVALPELDLGGGYGIAYTAAEEPLNVAEVASDLLTAV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


BSSB
SS








B



STTS



 .........290.........300.........310.........320.........330.........340.........350
Sequence GKMAAELGIDAPTVLVEPGRAIAGPSTVTIYEVGTTKDVHVDDDKTRRYIAVDGGMSDNIRPALYGSEYD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS


B

SSTTSSSS
S

TTT






 .........360.........370.........380.........390.........400.........410.........420
Sequence ARVVSRFAEGDPVSTRIVGSHCESGDILINDEIYPSDITSGDFLALAATGAYCYAMSSRYNAFTRPAVVS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SBS


S

SSSSTT
TT

TT
S

TTTTGGG


GGG



 .........430.........440...
Sequence VRAGSSRLMLRRETLDDILSLEK
Predicted secondary structure







SS confidence






















Known secondary structure (DSSP) TT



T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D