Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x7nA_

Fold library idPDB HeaderMoleculeTitle
c5x7nA_1.72PDB header: lyaseChain: A: PDB Molecule: diaminopimelate decarboxylase;


Added to library: Sat Jan 13 08:23:54 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TVENFNELPAHVWPRNAVRQEDGVVTVAGVPLPDLAEEYGTPLFVVDEDDFRSRCRDMATAFGGPGNVHY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
T


TTTS
TT
TTSBTT
SSTTSGGGB
 .........80.........90.........100.........110.........120.........130.........140
Sequence ASKAFLTKTIARWVDEEGLALDIASINELGIALAAGFPASRITAHGNNKGVEFLRALVQNGVGHVVLDSA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) GGG


TT

STT

GGG

TT

T
S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence QELELLDYVAAGEGKIQDVLIRVKPGIEAHTHEFIATSHEDQKFGFSLASGSAFEAAKAANNAENLNLVG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T


S
SS

S


SSSSSTTS
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LHCHVGSQVFDAEGFKLAAERVLGLYSQIHSELGVALPELDLGGGYGIAYTAAEEPLNVAEVASDLLTAV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


BSSB
SS








B



STTS



 .........290.........300.........310.........320.........330.........340.........350
Sequence GKMAAELGIDAPTVLVEPGRAIAGPSTVTIYEVGTTKDVHVDDDKTRRYIAVDGGMSDNIRPALYGSEYD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS


B

SSTTSSSS
S

TTT






 .........360.........370.........380.........390.........400.........410.........420
Sequence ARVVSRFAEGDPVSTRIVGSHCESGDILINDEIYPSDITSGDFLALAATGAYCYAMSSRYNAFTRPAVVS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SBS


S

SSSSTT
TT

TT
S

TTTTGGG


GGG



 .........430.........440...
Sequence VRAGSSRLMLRRETLDDILSLEK
Predicted secondary structure







SS confidence






















Known secondary structure (DSSP) TT



T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D