Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x70D_

Fold library idPDB HeaderMoleculeTitle
c5x70D_3.30PDB header: transferase/rnaChain: D: PDB Molecule: mrna capping enzyme p5;


Added to library: Sat Mar 3 08:29:45 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DYCIPNFSQTVNERTIIDIFTICRYRSPLVVFCLSHNELAKKYAQDVSMSSGTHVHIIDGSVEITVSLYR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


SS

TTT
SGGG


S



SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TFRTIATQLLGRMQIVVFVTVDKSVVSTQVMKSIAWAFRGSFVELRNQSVDSSTLVSKLENLVSFAPLYN
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTSS


S
TTTS
TTTTS
TT
TTS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VPKCGPDYYGPTVYSELLSLATNARTHWYATIDYSMFTRSVLTGFVAKYFNEEAVPIDKRIVSIVGYNPP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S
BTSSB

SS

GGGGG
TTTTT




TT

GGG
S

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YVWTCLRHGIRPTYIEKSLPNPGGKGPFGLILPVCLDTFMLSTSMNILYIGAYPATHLLSLQLNGWTILA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
S






BTTTT
BS



SS


STTT
S


SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FDPKITSDWTDAMAKATGAKVIGVSKEFDFKSFSVQANQLNMFQNSKLSVIDDEKQAYFEWLIDRTSIDV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TT


S


S
S
SSSS
TTSTTGGGS
SS




S





SS
SS

 .........360.........370.........380.........390.........400.........410.........420
Sequence RLISMKKDTSVSLALLRAFFHAETEKYMDDFTAMSVSDQINTQKFMHCMITTVGDALKMDLDGGRAVIAS
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
















GGG




TTGGGS
GGG



SS

T
 .........430.........440.........450.........460.........470.........480.........490
Sequence YSLSNSSNSKERVLKFLSDANKAKAMVVFGAPNTHRLAYAKKVGLVLDSAIKMSKDLITFSNWRDYGYSQ
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTTBTTS
TT
BTTSS
TTTTT



B
 .........500.........510.........520.........530.........540.........550.........560
Sequence SELYDAGYVEITIDQMVAYSSDVYNGVGYFANSTYNDLFSWYIPKWYVHKRMLMQDIRLSPAALVKCFTT
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT
TGGG

SB
BSS

TSSS

STTS
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence LIRNICYVPHETYYRFRGILVDKYLRSKNVDPSQYSIVGSGSKTFTVLSHFEVPHECGPLVFEASTDVNI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT

GGGT

GGG

SSS
S
S


TTS

TT

 .........640.........650.........660.........670.........680.........690.........700
Sequence SGHLLSLAIAAHFVASPMILWAEQMKYMAVDRMLPPNLDKSLFFDNKVTPSGALQRWHSREEVLLAAEIC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TTTS


TTS


SSS
GGGGTTS
B
TTS




T
 .........710.........720.........730
Sequence ESYAAMMLNNKHSPDIIGTLKSAINLVFKI
Predicted secondary structure







SS confidence





























Known secondary structure (DSSP) TTT
S
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D