Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x70D_

Fold library idPDB HeaderMoleculeTitle
c5x70D_3.30PDB header: transferase/rnaChain: D: PDB Molecule: mrna capping enzyme p5;


Added to library: Sat Mar 3 08:29:45 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DYCIPNFSQTVNERTIIDIFTICRYRSPLVVFCLSHNELAKKYAQDVSMSSGTHVHIIDGSVEITVSLYR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


SS

TTT
SGGG


S



SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TFRTIATQLLGRMQIVVFVTVDKSVVSTQVMKSIAWAFRGSFVELRNQSVDSSTLVSKLENLVSFAPLYN
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTSS


S
TTTS
TTTTS
TT
TTS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VPKCGPDYYGPTVYSELLSLATNARTHWYATIDYSMFTRSVLTGFVAKYFNEEAVPIDKRIVSIVGYNPP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S
BTSSB

SS

GGGGG
TTTTT




TT

GGG
S

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YVWTCLRHGIRPTYIEKSLPNPGGKGPFGLILPVCLDTFMLSTSMNILYIGAYPATHLLSLQLNGWTILA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
S






BTTTT
BS



SS


STTT
S


SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FDPKITSDWTDAMAKATGAKVIGVSKEFDFKSFSVQANQLNMFQNSKLSVIDDEKQAYFEWLIDRTSIDV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TT


S


S
S
SSSS
TTSTTGGGS
SS




S





SS
SS

 .........360.........370.........380.........390.........400.........410.........420
Sequence RLISMKKDTSVSLALLRAFFHAETEKYMDDFTAMSVSDQINTQKFMHCMITTVGDALKMDLDGGRAVIAS
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
















GGG




TTGGGS
GGG



SS

T
 .........430.........440.........450.........460.........470.........480.........490
Sequence YSLSNSSNSKERVLKFLSDANKAKAMVVFGAPNTHRLAYAKKVGLVLDSAIKMSKDLITFSNWRDYGYSQ
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTTBTTS
TT
BTTSS
TTTTT



B
 .........500.........510.........520.........530.........540.........550.........560
Sequence SELYDAGYVEITIDQMVAYSSDVYNGVGYFANSTYNDLFSWYIPKWYVHKRMLMQDIRLSPAALVKCFTT
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT
TGGG

SB
BSS

TSSS

STTS
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence LIRNICYVPHETYYRFRGILVDKYLRSKNVDPSQYSIVGSGSKTFTVLSHFEVPHECGPLVFEASTDVNI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT

GGGT

GGG

SSS
S
S


TTS

TT

 .........640.........650.........660.........670.........680.........690.........700
Sequence SGHLLSLAIAAHFVASPMILWAEQMKYMAVDRMLPPNLDKSLFFDNKVTPSGALQRWHSREEVLLAAEIC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TTTS


TTS


SSS
GGGGTTS
B
TTS




T
 .........710.........720.........730
Sequence ESYAAMMLNNKHSPDIIGTLKSAINLVFKI
Predicted secondary structure







SS confidence





























Known secondary structure (DSSP) TTT
S
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D