Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x6oG_

Fold library idPDB HeaderMoleculeTitle
c5x6oG_3.90PDB header: transferase/dna binding proteinChain: G: PDB Molecule: dna damage checkpoint protein lcd1;


Added to library: Sat Dec 23 08:51:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RETVGEFSSDDDDDIGTRPPRFTQIPPSSAATQIPTTLEVTTTTLNNKQSKNDNQVNQLNKAQGEASMLR
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
T


TT



TTSSTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence DNIEREKEKNIQAVKVNELVKHLQELAKLKQELQKLEDEKKFLQRGKSKREVITNVKPPSTTLNTITPDS
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


TTGGG

TTT


TTTTTTTTTTTS

TT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SSVAIEAKPQSPQSKKRKISDNLLKKNMVPLNPNRIIPDETSLFLESILLHQIIGADLSTIEILNRLKLD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SS

SSS

STTTTTSTTT

S




TT


SSSTTTTTTTTSS



 .........220.........230.........240.........250.........260.........270.........280
Sequence YITEFKFKNFVIAKGAPIGKSIVSLLLRCKKTLTLDRFIDTLLEDIAVLIKEISVHPNESKLAVPFLVAL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

SSS
SSS
TT

S
SSS


 .........290.........300.........310.........320.........330.........340.........350
Sequence MYQIVQFRPSATHNLALKDCFLFICDLIRIYHHVLKVPIHESNMNLHVEPQIFQYELIDYLIISYSFDLL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TSS
TTT
SS

TTTT

SS

TT



S

B
 .........360.........370.........380.........390.........400.........410.........420
Sequence EGILRVLQSHPKQTYMEFFDENILKSFEFVYKLALTISYKPMVNVIFSAVEVVNIITSIILNMDNSSDLK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTS
TTT

S
SSS


SSSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence SLISGSWWRDCITRLYALLEKEIKSGDVYNENVDTTTLHMSKYHDFFGLIRNIGDNELGGLISKLIYTDR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT

TTT



TTSSSS


TTT




SSS



SSS

S

TTTTGGGTSS
SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence LQSVPRVISKEDIGTAPIIGYKMEKWLLKLKDEVLNIFENLLMIYGDDATIVNGEMLIHSSKFLSREQAL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

SS



BTTS



STGGGGTTT
STT
 .........570.........580.........590.........600.........610.........620.........630
Sequence MIERYVGQDSPNLDLRCHLIEHTLTIIYRLWKDHFKQLEEQIKQVESQLIMSLWRFLVCQTETANEREMR
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTTS

TTT
S





TTTGGGG


S
 .........640.........650.........660.........670.........680.........690.........700
Sequence DHRHLVDSLHDLTIKDQASYYEDAFEDLPEYIEEELKMQLNKRTGRIMQKFQEMARTILESKSTLEEADS
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTTSS

S

SS
TTT

TTTTT

 ....
Sequence LYIS
Predicted secondary structure

SS confidence



Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D