Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x6oG_

Fold library idPDB HeaderMoleculeTitle
c5x6oG_3.90PDB header: transferase/dna binding proteinChain: G: PDB Molecule: dna damage checkpoint protein lcd1;


Added to library: Sat Dec 23 08:51:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RETVGEFSSDDDDDIGTRPPRFTQIPPSSAATQIPTTLEVTTTTLNNKQSKNDNQVNQLNKAQGEASMLR
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
T


TT



TTSSTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence DNIEREKEKNIQAVKVNELVKHLQELAKLKQELQKLEDEKKFLQRGKSKREVITNVKPPSTTLNTITPDS
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


TTGGG

TTT


TTTTTTTTTTTS

TT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SSVAIEAKPQSPQSKKRKISDNLLKKNMVPLNPNRIIPDETSLFLESILLHQIIGADLSTIEILNRLKLD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SS

SSS

STTTTTSTTT

S




TT


SSSTTTTTTTTSS



 .........220.........230.........240.........250.........260.........270.........280
Sequence YITEFKFKNFVIAKGAPIGKSIVSLLLRCKKTLTLDRFIDTLLEDIAVLIKEISVHPNESKLAVPFLVAL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

SSS
SSS
TT

S
SSS


 .........290.........300.........310.........320.........330.........340.........350
Sequence MYQIVQFRPSATHNLALKDCFLFICDLIRIYHHVLKVPIHESNMNLHVEPQIFQYELIDYLIISYSFDLL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TSS
TTT
SS

TTTT

SS

TT



S

B
 .........360.........370.........380.........390.........400.........410.........420
Sequence EGILRVLQSHPKQTYMEFFDENILKSFEFVYKLALTISYKPMVNVIFSAVEVVNIITSIILNMDNSSDLK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTS
TTT

S
SSS


SSSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence SLISGSWWRDCITRLYALLEKEIKSGDVYNENVDTTTLHMSKYHDFFGLIRNIGDNELGGLISKLIYTDR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT

TTT



TTSSSS


TTT




SSS



SSS

S

TTTTGGGTSS
SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence LQSVPRVISKEDIGTAPIIGYKMEKWLLKLKDEVLNIFENLLMIYGDDATIVNGEMLIHSSKFLSREQAL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

SS



BTTS



STGGGGTTT
STT
 .........570.........580.........590.........600.........610.........620.........630
Sequence MIERYVGQDSPNLDLRCHLIEHTLTIIYRLWKDHFKQLEEQIKQVESQLIMSLWRFLVCQTETANEREMR
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTTS

TTT
S





TTTGGGG


S
 .........640.........650.........660.........670.........680.........690.........700
Sequence DHRHLVDSLHDLTIKDQASYYEDAFEDLPEYIEEELKMQLNKRTGRIMQKFQEMARTILESKSTLEEADS
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTTSS

S

SS
TTT

TTTTT

 ....
Sequence LYIS
Predicted secondary structure

SS confidence



Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D