Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x6oC_

Fold library idPDB HeaderMoleculeTitle
c5x6oC_3.90PDB header: transferase/dna binding proteinChain: C: PDB Molecule: serine/threonine-protein kinase mec1;


Added to library: Sat Dec 23 08:48:01 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YAEIQLKYISLVVDYVCNRTISTALDAPALVCCEQLKFVLTTMHHFLDNKYGLLDNDPTMAKGILRLYSL
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)

TS



TT



S





SS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence CISNDFSKCFVDHFPIDQWADFSQSETNKALSIVYFDLKRRSLPVEALKYDNKFNIWVYQSPDSSLKNVT
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTSTTS
GGGT


SS



SSS
S




SSS
S






GGGTSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence SPFDDRYKQLEKLRLLVLLLKYRVNQLSPFKLILNEASVSIQTCFKTNNITRLTSWTVILGRLACLESEK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)

STTT






SS
SGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence FMDNWYVCHLCDIEKTGNPFVRINPNRPEAAGKSEIFRILHSNFLSHPNIDEFSESLLSGILFSLHRIFS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


S

S



SS
GGGSS
SS

BTTTS
SSSSTTSS

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence HFQPPKQINKSFKLVQKCFMNSNRYLRLLSTRIIPLFNISDSHNSEDEHTATLIKFLQSQKLPVVKENLV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SB




TTSS
TT

SSTTSSST


TTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IAWTQLTLTTSNDVFDTLLLKLIDIFNSDDYSLRIMMTLQIKNMAKILKKTPYQLLSPILPVLLRQLGKN
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)

TSS
T

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence LVERKVGFQNLIELLGYSSKTILDIFQRYIIPYAIIQYKSDVLSEIAKIMCDGTSLINQMKVNLLKKNSR
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) GGGT
S
S
SSS
TT


T

TT
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence QIFAVALVKHGLFSLDILETLFLNRAYITAYLPDYTLAEITKLYKNSSDSENANMILCSLRFLITNFEKD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) SS


TTT

STT

GGG


TT

SS
 .........570.........580.........590.........600.........610.........620.........630
Sequence KRHGSKYKNINWTDDQEQAFQKKLQDNILGIFQVFSSDIHDVEGRTTYYEKLRVINGISFLIIYAPKKSI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) STTT



TTTS

SS

TS

 .........640.........650.........660.........670.........680.........690.........700
Sequence ISALAQISICLQTGLGLKEVRYEAFRCWHLLVRHLNDEELSTVIDSLIAFILQKWSEFNGKLRNIVYSIL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTTSGGGSS
SS
SSTTSGGG
TT
 .........710.........720.........730.........740.........750.........760.........770
Sequence DTLIKEKSDLILKLKPYTTLALVGKPELGILARDGQFARMVNKIRSTTDLIPIFANNLKSSNKYVINQNL
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) T
SSTTTTTS
GGG
TTTSS
STS

TTS

TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence DDIEVYLRRKQTERSIDFDITLVLGALLDTSHKFRNLDKDLCEKCAKCISMIGVLDVTKHEFKRTTYSEN
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T




TSSSS
TT



TTS










 .........850.........860.........870.........880.........890.........900.........910
Sequence EVYDLNDSVQTIKFLIWVINDILVPAFWQSENPSKQLFVALVIQESLKYCGLSSESWDMNHKELYPNEAK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



SS
TTTTTT


TTTTT
ST
STTT
S

S
T
 .........920.........930.........940.........950.........960.........970.........980
Sequence LWEKFNSVSKTTIYPLLSSLYLAQSWKEYVPLKYPSNNFEGYKIWVKRFTLDLLKTGTTENHPLHVFSSL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTTTTT







SSSSTT


SSTT

T

SSSSGGGG
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence IRGSLSNFLLPYISLDIIIKAPYADILNGIIIEFDSIFTCNLEGMNNLQVDSLRMCYESIFRVFEYCKKW
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) T


ST








S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence ATEFKQNYSKLHGTFIIKDTKTTNMLLRIDEFLRTTPSDLLAQRSLETDSFERSALYLEQCYRQNPHDKN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TSS
SSS

STTTTTT

S
SS


 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence QNGQLLKNLQITYEEIGDIDSLDGVLRTFATGNLVSKIEELQYSENWKLAQDCFNVLGKFDPKTTTRMLK
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

T

S
GGGGGTT

TT
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence SMYDHQLYSQIISNSSFVKEWYSIGLEAANLEGNVQTLKNWVEQIESLRNIDDREVLLQYNIAKALIAIS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
TTTT





SS



 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence NEDPLRTQKYIHNSFRLIGTNFITSSKETTLLKKQNLLMKLHSLYDLSFLSSAKDKFEYKSNTTILDYRM
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TT
TTTS


S

S
SGGGTT

STTTG
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence ERIGADFVPNHYILSMRKSFDQLKMNEQADADLGKTFFTLAQLARNNARLDIASESLMHCLERRLPQAEL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) GGG
S
T

TT
TTTTT
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence EFAEILWKQGENDRALKIVQEIHEKYQENSSVNARDRAAVLLKFTEWLDLSNNSASEQIIKQYQDIFQID
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) SS
TTT

S
SST
S

GGGS
 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence SKWDKPYYSIGLYYSRLLERKGRFEYRAISYFLLAFEKNTAKVRENLPKVITFWLDIAAASISENRKEML
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) STT

T

GGGGG


TTT

 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence SKATEDICSHVEEALQHPTYIWYFVLTQLLSRLLAQIIMHILLSLAVEYPSHILWYITALVNSNSSKRVL
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) T

TTTTT

TTTT
T
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence HILEKYRQHSQNPHDLVSSALLTRVCLQDVKSITSRSGKSLENVAPSAMVVPVRKNLDIISPLESNSPFR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

TT




TTT






S


SS








G
 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence PVVSIIRFGSSYKVFSSLKKPKQLNIIGSDGNIYGIMCKKEDVRQDNQYMQFATTMDFLLSKDIASRKRS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGGTT













SSS




B
SSS
B







GGGSTTTTGGGT
 .........1760.........1770.........1780.........1790.........1800.........1810.........1820
Sequence LGINIYSVLSLREDCGILEMVPNVVTLRSILSTKYESLKIKYSLKSLHDRWQHTAVDGKLEFYMEQVDKF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)










SSS






SSB

TT




TTT

TTSSTTTTTS
 .........1830.........1840.........1850.........1860.........1870.........1880.........1890
Sequence PPILYQWFLENFPDPINWFNARNTYARSYAVMAMVGHILGLGDRHCENILLDIQTGKVLHVDFDCLFEKG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


TTS
STTT




STT


BSSS





S


S

S
 .........1900.........1910.........1920.........1930.........1940.........1950.........1960
Sequence KFRLTPNLLDALGIIGTEGTFKKSSEVTLALMRKNEVALMNVIETIMYDRNMDHSIQKALKVLRNKIRGI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)




TTTTT
SSTSTT


SS


GGGT
 .........1970.........1980.........1990.......
Sequence DPQDGLVLSVAGQTETLIQEATSEDNLSKMYIGWLPF
Predicted secondary structure


















SS confidence




































Known secondary structure (DSSP) SSSTT



TT
STS
GGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D