Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x68B_

Fold library idPDB HeaderMoleculeTitle
c5x68B_2.10PDB header: oxidoreductaseChain: B: PDB Molecule: kynurenine 3-monooxygenase;


Added to library: Sat Feb 24 08:56:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVAGRSINLALSHRGRQALKAVGLEDQIVSQGIP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



STT

SS

TTT



S
TT
TS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLCNPEEGMITVLGSD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTS

SSGGG
TSTTTT


BGGGT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence KVPKDVTCDLIVGCDGAYSTVRSHLMKPRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


S


TT







GGGB
S

SSSS
SS
TT
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVCSSFH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTS
T

S
TT
TTS

B

B




SB
 .........290.........300.........310.........320.........330.........340.........350
Sequence FSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDSDLSMYNYIEMR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)



GGGT



TTT

TTT
TT


TT









Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D