Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x68B_

Fold library idPDB HeaderMoleculeTitle
c5x68B_2.10PDB header: oxidoreductaseChain: B: PDB Molecule: kynurenine 3-monooxygenase;


Added to library: Sat Feb 24 08:56:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVAGRSINLALSHRGRQALKAVGLEDQIVSQGIP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



STT

SS

TTT



S
TT
TS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLCNPEEGMITVLGSD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTS

SSGGG
TSTTTT


BGGGT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence KVPKDVTCDLIVGCDGAYSTVRSHLMKPRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


S


TT







GGGB
S

SSSS
SS
TT
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVCSSFH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTS
T

S
TT
TTS

B

B




SB
 .........290.........300.........310.........320.........330.........340.........350
Sequence FSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDSDLSMYNYIEMR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)



GGGT



TTT

TTT
TT


TT









Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D