Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x5iC_

Fold library idPDB HeaderMoleculeTitle
c5x5iC_2.55PDB header: transcriptionChain: C: PDB Molecule: hth-type transcriptional regulator rcda;


Added to library: Sat Dec 30 08:43:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PQRREKIIQATLEAVKLYGIAVTHRKIATLAPLGSXTYYFSGIDELLLEAFSSFTEIXSRQYQAFFSDVS
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
TTS




T



SSS

TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence DAPGACQAITDXIYSSQVATPDNXELXYQLYALASRKPLLKTVXQNWXQRSQQTLEQWFEPGTARALDAF
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SS

TT
TTTS
 .........150.........160.........170.
Sequence IEGXTLHFVTDRKPLSREEILRXVERVAGAA
Predicted secondary structure








SS confidence






























Known secondary structure (DSSP)





S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D