Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x3kA_

Fold library idPDB HeaderMoleculeTitle
c5x3kA_2.50PDB header: hydrolaseChain: A: PDB Molecule: glycoside hydrolase family 31;


Added to library: Sat Feb 10 08:34:32 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIKHRPHGIEHPYAVSPDQRVPVLPLAGEPVLLGVVAPEADRVVCEWGTLELPLSATHLSEAQAKSLGAD
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)

B

SSTT

TT


TTSSSS
BTT



SS
STT




TT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GAWSVQTPPLAEPVKYRFHAHRGGAAESTEWFEVSPAVWTADGVGEVRGGGERVRGVEWLVSSQGVHRGR
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) T



SS
TT




BS
SS
S
GGGTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FRLQLQDGDRLVGFGERYDALDQRGRELDAVVFEQYKAQGVHGRTYLPMPFAHVVGADGNGWGFHVRTSR
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TT
S
SS
S

TT






S
T

SS
SSS



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RTWYSSAGNELTVEVALGDEPVVDLAIYEGDPATVLTGFLDEVGRAEELPGWVFRLWASGNEWNTQQLVT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT

SS
SS






GGGGS

TT

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence ARMDTHRDLAIPVGAVVIEAWSDEQGITIWRDAVYAVTEDGSAHRAEDFSYRPDGAWPDPKAMIDELHAR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT


SSS
B
SSSSSSBTT



TT




GGG

TTSS
S
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence GIKVILWQIPLQKTEFSTGQVAADAAAMVRDGHAVLEADGTAYRNRGWWFPQALMPDLSVQRTRDWWTEK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) T

S
B

S
SSSTT
B
B
TTSSB



SSSSTT
B
B
TTST
 .........430.........440.........450.........460.........470.........480.........490
Sequence RRYLVEHFDVDGFKTAGGEHAWGHDLVYADGRKGDEGNNLYPVHYARAFGDLLRSAGKAPVTFSRAGFTG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTS










TT
B
TTS
BTTTTTS


S


TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence SQAHGIFWAGDEDSTWQAFRSSVTAGLTAASCGIVYWGWDLAGFSGPVPDAELYLRAAAASAFMPIMQYH
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) GGGSS



BSSTT

STT
SBSS


TTSS

 .........570.........580.........590.........600.........610.........620.........630
Sequence SEFNHHQLPLRDRTPWHVAETTGDDRVVPLFRRFATLRESLVPYLTEQAARTIATDRPLMRPLFFDHEND
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



TT
SS




T
TT


S
TTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence PEIWNHPYQYLLGDELLINPVLEPGATTWTTYLPAGEWIDVWTGDRVPSGLVTRDVPLEVVPVYCRASRW
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGGGG
TT
TTT



STT
S
SS
TTT


S

TT


GGG
 ........
Sequence SELQPVFS
Predicted secondary structure







SS confidence







Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D