Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x3kA_

Fold library idPDB HeaderMoleculeTitle
c5x3kA_2.50PDB header: hydrolaseChain: A: PDB Molecule: glycoside hydrolase family 31;


Added to library: Sat Feb 10 08:34:32 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIKHRPHGIEHPYAVSPDQRVPVLPLAGEPVLLGVVAPEADRVVCEWGTLELPLSATHLSEAQAKSLGAD
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)

B

SSTT

TT


TTSSSS
BTT



SS
STT




TT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GAWSVQTPPLAEPVKYRFHAHRGGAAESTEWFEVSPAVWTADGVGEVRGGGERVRGVEWLVSSQGVHRGR
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) T



SS
TT




BS
SS
S
GGGTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FRLQLQDGDRLVGFGERYDALDQRGRELDAVVFEQYKAQGVHGRTYLPMPFAHVVGADGNGWGFHVRTSR
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TT
S
SS
S

TT






S
T

SS
SSS



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RTWYSSAGNELTVEVALGDEPVVDLAIYEGDPATVLTGFLDEVGRAEELPGWVFRLWASGNEWNTQQLVT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT

SS
SS






GGGGS

TT

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence ARMDTHRDLAIPVGAVVIEAWSDEQGITIWRDAVYAVTEDGSAHRAEDFSYRPDGAWPDPKAMIDELHAR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT


SSS
B
SSSSSSBTT



TT




GGG

TTSS
S
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence GIKVILWQIPLQKTEFSTGQVAADAAAMVRDGHAVLEADGTAYRNRGWWFPQALMPDLSVQRTRDWWTEK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) T

S
B

S
SSSTT
B
B
TTSSB



SSSSTT
B
B
TTST
 .........430.........440.........450.........460.........470.........480.........490
Sequence RRYLVEHFDVDGFKTAGGEHAWGHDLVYADGRKGDEGNNLYPVHYARAFGDLLRSAGKAPVTFSRAGFTG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTS










TT
B
TTS
BTTTTTS


S


TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence SQAHGIFWAGDEDSTWQAFRSSVTAGLTAASCGIVYWGWDLAGFSGPVPDAELYLRAAAASAFMPIMQYH
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) GGGSS



BSSTT

STT
SBSS


TTSS

 .........570.........580.........590.........600.........610.........620.........630
Sequence SEFNHHQLPLRDRTPWHVAETTGDDRVVPLFRRFATLRESLVPYLTEQAARTIATDRPLMRPLFFDHEND
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



TT
SS




T
TT


S
TTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence PEIWNHPYQYLLGDELLINPVLEPGATTWTTYLPAGEWIDVWTGDRVPSGLVTRDVPLEVVPVYCRASRW
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGGGG
TT
TTT



STT
S
SS
TTT


S

TT


GGG
 ........
Sequence SELQPVFS
Predicted secondary structure







SS confidence







Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D