Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x33A_

Fold library idPDB HeaderMoleculeTitle
c5x33A_3.70PDB header: membrane proteinChain: A: PDB Molecule: ltb4 receptor,lysozyme,ltb4 receptor;


Added to library: Sat Jan 6 09:02:14 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNTFIPLLAMILLSVSMVVGLPGNTFVVWSILKRMRKRSVTALMVLNLALADLAVLLTAPFFLHFLTWGT
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
TTS
SS

TSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence WSFGLAGCRLCHYICGVSMYASVLLITAMSLDRSLAVASPFLSQKVRTKTAARWLLVGIWGASFLLATPV
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)

STT


TTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LAFRKVVKLTNETDLCLAVYPSDRHKAFHLLFEAFTGFVVPFLIVVASYADISRRLRARGSGSNIFEMLR
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT

SSTTT
STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGI
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)



B

TTS
TTT

S
S
TT
S

SSB

 .........290.........300.........310.........320.........330.........340.........350
Sequence LRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKR
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T
TTS

TT
TT

TTGGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VITTFRTGTWDAYGSGSRFHRRRRTGRLVVIIILAFAAFWLPYHVVDLVEGSRVLAGDQSKQQLRNARKV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
SSTTT
SSS






TTTTTTTS



ST
 .........430.........
Sequence CIALAFLSSSVNPLLYACA
Predicted secondary structure

SS confidence


















Known secondary structure (DSSP) GGGGGGSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D