Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x32B_

Fold library idPDB HeaderMoleculeTitle
c5x32B_2.59PDB header: isomeraseChain: B: PDB Molecule: n-acylglucosamine 2-epimerase;


Added to library: Sat Feb 10 08:29:57 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SYPAFDSKTFLEAHIEKTMAFYFPTCIDPEGGFFQFFKDDGSVYDPNTRHLVSSTRFIFNFAQAYLHTNI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



TT
TTTTB
TTSSB


B
TTS
BS
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence AEYKHAAVHGIQYLRQRHQSQSGGYVWLLDGGTNLDETNHCYGLAFVILAYSNALQIGLSEAEVWIEVTY
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TB
TTS
B
STT

TT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLLETHFWENKHGLYLDEISSDWKTVSPYRGQNANMHMCEALMSAFDATQNPKYLDRAKLLAKNICQKQA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTTT
S
TTS

B
S


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence SLSNSNEVWEHYTNDWQIDWDYNKNDPKHLFRPWGFQPGHQTEWAKLLLMLDKRSPENWYLPKAKYLFDL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TSTT



S
TTS
B
SSTTSSSTT
SSS
SSB
S

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AYKKAWDTKKGGLHYGYAPDGTVCDPDKYFWVQAESFAAAWLLYKATKDETYYKQYLTLWEFSWNHMIDH
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) B
TTT
SB
TTS


TB
T
 .........360.........370.........380.........390.
Sequence TFGAWYRILDENNAQYDNNKSPAGKTDYHTMGACYEVLKTL
Predicted secondary structure






















SS confidence








































Known secondary structure (DSSP) TT
SB
S
TTS
BSSS
SB
TT
SST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D