Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x32B_

Fold library idPDB HeaderMoleculeTitle
c5x32B_2.59PDB header: isomeraseChain: B: PDB Molecule: n-acylglucosamine 2-epimerase;


Added to library: Sat Feb 10 08:29:57 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SYPAFDSKTFLEAHIEKTMAFYFPTCIDPEGGFFQFFKDDGSVYDPNTRHLVSSTRFIFNFAQAYLHTNI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



TT
TTTTB
TTSSB


B
TTS
BS
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence AEYKHAAVHGIQYLRQRHQSQSGGYVWLLDGGTNLDETNHCYGLAFVILAYSNALQIGLSEAEVWIEVTY
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TB
TTS
B
STT

TT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLLETHFWENKHGLYLDEISSDWKTVSPYRGQNANMHMCEALMSAFDATQNPKYLDRAKLLAKNICQKQA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTTT
S
TTS

B
S


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence SLSNSNEVWEHYTNDWQIDWDYNKNDPKHLFRPWGFQPGHQTEWAKLLLMLDKRSPENWYLPKAKYLFDL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TSTT



S
TTS
B
SSTTSSSTT
SSS
SSB
S

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AYKKAWDTKKGGLHYGYAPDGTVCDPDKYFWVQAESFAAAWLLYKATKDETYYKQYLTLWEFSWNHMIDH
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) B
TTT
SB
TTS


TB
T
 .........360.........370.........380.........390.
Sequence TFGAWYRILDENNAQYDNNKSPAGKTDYHTMGACYEVLKTL
Predicted secondary structure






















SS confidence








































Known secondary structure (DSSP) TT
SB
S
TTS
BSSS
SB
TT
SST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D