Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x06G_

Fold library idPDB HeaderMoleculeTitle
c5x06G_3.24PDB header: replicationChain: G: PDB Molecule: dnaa regulatory inactivator hda;


Added to library: Sat Jan 27 08:24:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AQLSLPLYDDETFASFWPGDNSSLLAALQNVLRQEHSGYIYLWAREGAGRSHLLHAACAELSQRGDAVGY
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)









SSTTTS

SS
SSTT



SSSSSTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence VPLDKRTWFVPEVLDGMEHLSLVCIDNIECIAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) GGGGGGS
GGGGTTGGGSS
GGGGTT
S
S


SS
TTT


S
 .........150.........160.........170.........180.........190.........200.....
Sequence LPDLASRLDWGQIYKLQPSDEDKLQALQLRARLEDVGRFLLKMRTLFMTLDQLDRASITATIPFV
Predicted secondary structure












SS confidence
































































Known secondary structure (DSSP)
TSS





TT




TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D