Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wzeC_

Fold library idPDB HeaderMoleculeTitle
c5wzeC_1.78PDB header: hydrolaseChain: C: PDB Molecule: aminopeptidase p;


Added to library: Sat Jan 20 10:36:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIRIPKSEYARRRKALMAQMEPNSIAILPAAPMYIRNRDVEHVYRQDSDFQYLTGFPEPEAVMALIPGRA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)




TTS
SS




TT









SS

TT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence HGEYVLFCRERDPERELWDGLRAGQDGAIGQYGADDAFPIGDIDDILPGLIEGRDRVYYALGANPDFDRR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T
S







TS

SGGGTT
S
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LMDWINVIRSKARQGAQPPNEFVALDHLLHDQRLYKSANEVKVMRYAAEVSARAHIRAMEVCRPGLFEYH
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TGGGT



STS



TTSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence LEAELEYEFRKGGAKMPAYGSIVAAGRNACILHYRENDAAIKDGDLILIDAGCEIDCYASDITRTFPANG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT
SSBSS

GGGGGSTT





B

TT

BTT

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence RFSPEQKAIYELVLEANMAAFDYIAPGRHWNEAHEATVRVITAGLVRLGLLEGDVDELIAHEAYKAFYMH
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


TT
STTSBTTTSS
S
TTGGGGT

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence RAGHWLGMDVHDVGEYRVGGEWRVLEPGMAMTVEPGIYIAPDNTTVAKKWRGIGVRIEDDVVVTRNGCEV
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
S

B
SSSSS

S
STT
B

TT




TT
TTS
GGGTT

B
SSS
 .........430.........440...
Sequence LTNGVPKTVAEIEALMAAAKSEP
Predicted secondary structure













SS confidence






















Known secondary structure (DSSP) S
TTS

ST



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D