Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wzeC_

Fold library idPDB HeaderMoleculeTitle
c5wzeC_1.78PDB header: hydrolaseChain: C: PDB Molecule: aminopeptidase p;


Added to library: Sat Jan 20 10:36:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIRIPKSEYARRRKALMAQMEPNSIAILPAAPMYIRNRDVEHVYRQDSDFQYLTGFPEPEAVMALIPGRA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)




TTS
SS




TT









SS

TT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence HGEYVLFCRERDPERELWDGLRAGQDGAIGQYGADDAFPIGDIDDILPGLIEGRDRVYYALGANPDFDRR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T
S







TS

SGGGTT
S
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LMDWINVIRSKARQGAQPPNEFVALDHLLHDQRLYKSANEVKVMRYAAEVSARAHIRAMEVCRPGLFEYH
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TGGGT



STS



TTSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence LEAELEYEFRKGGAKMPAYGSIVAAGRNACILHYRENDAAIKDGDLILIDAGCEIDCYASDITRTFPANG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT
SSBSS

GGGGGSTT





B

TT

BTT

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence RFSPEQKAIYELVLEANMAAFDYIAPGRHWNEAHEATVRVITAGLVRLGLLEGDVDELIAHEAYKAFYMH
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


TT
STTSBTTTSS
S
TTGGGGT

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence RAGHWLGMDVHDVGEYRVGGEWRVLEPGMAMTVEPGIYIAPDNTTVAKKWRGIGVRIEDDVVVTRNGCEV
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
S

B
SSSSS

S
STT
B

TT




TT
TTS
GGGTT

B
SSS
 .........430.........440...
Sequence LTNGVPKTVAEIEALMAAAKSEP
Predicted secondary structure













SS confidence






















Known secondary structure (DSSP) S
TTS

ST



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D