Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wyrA_

Fold library idPDB HeaderMoleculeTitle
c5wyrA_2.45PDB header: transferaseChain: A: PDB Molecule: trna (guanine-n(1)-)-methyltransferase;


Added to library: Sat Dec 23 08:30:10 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SMLWVGVVSIFPEMFRAISDYGITSRAVKQGLLTLTCWNPRVYTEDRHQTVDDRPFGGGPGMVMKIKPLE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


S
GGGGSSTTS
GGGG
SSTT




TT

SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence GALADARQAAGGRKAKVIYLSPQGRQLTQAGVRELAEEEALILIAGRYEGIDERFIEEHVDEEWSIGDYV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTTS


T
S

BTT
B

SSSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LSGGELPAMVLVDAVTRLLPGALGEDSFTDGLLDCPHYTRPEVYADKRVPEVLLSGNHEHIRRWRLQQAL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SBSTTSTT




SSGGG







S
STT

GGGTS

 .........220.........230.........240..
Sequence GRTWERRADLLDSRSLSGEEQKLLAEYIRQRD
Predicted secondary structure








SS confidence































Known secondary structure (DSSP) T



TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D