Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wxkA_

Fold library idPDB HeaderMoleculeTitle
c5wxkA_1.80PDB header: transferaseChain: A: PDB Molecule: earp;


Added to library: Sat Mar 3 08:30:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PPFVCWIFCKVIDNFGDIGVSWRLARVLHRELGWQVHLWTDDVSALRALCPDLPDVPCVHQDIHVRTWHS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)





SSS

S
STT

SSSTTB
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence DAADIDTAPVPDVVIETFACDLPENVLHIIRRHKPLWLNWEYLSAEESNERLHLMPSPQEGVQKYFWFMG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
B

TT



STT











TT
B

BTTB




 .........150.........160.........170.........180.........190.........200.........210
Sequence FSEKSGGLIRERDYCEAVRFDTEALRERLMLPEKNASEWLLFGYRSDVWAKWLEMWRQAGSPMTLLLAGT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSTTS





TTT


TT




S




T



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence QIIDSLKQSGVIPQDALQNDGDVFQTASVRLVKIPFVPQQDFDQLLHLADCAVIRGEDSFVRAQLAGKPF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TSS
TTSS
STT
TT




GGGSSTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FWHIYPQDENVHLDKLHAFWDKAHGFYTPETVSAHRRLSDDLNGGEALSATQRLECWQTLQQHQNGWRQG
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)



GGGTGGGS
TTSS


T
 .........360.........370.....
Sequence AEDWSRYLFGQPSAPEKLAAFVSKH
Predicted secondary structure





SS confidence
























Known secondary structure (DSSP) TS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D