Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wxkA_

Fold library idPDB HeaderMoleculeTitle
c5wxkA_1.80PDB header: transferaseChain: A: PDB Molecule: earp;


Added to library: Sat Mar 3 08:30:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PPFVCWIFCKVIDNFGDIGVSWRLARVLHRELGWQVHLWTDDVSALRALCPDLPDVPCVHQDIHVRTWHS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)





SSS

S
STT

SSSTTB
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence DAADIDTAPVPDVVIETFACDLPENVLHIIRRHKPLWLNWEYLSAEESNERLHLMPSPQEGVQKYFWFMG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
B

TT



STT











TT
B

BTTB




 .........150.........160.........170.........180.........190.........200.........210
Sequence FSEKSGGLIRERDYCEAVRFDTEALRERLMLPEKNASEWLLFGYRSDVWAKWLEMWRQAGSPMTLLLAGT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSTTS





TTT


TT




S




T



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence QIIDSLKQSGVIPQDALQNDGDVFQTASVRLVKIPFVPQQDFDQLLHLADCAVIRGEDSFVRAQLAGKPF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TSS
TTSS
STT
TT




GGGSSTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FWHIYPQDENVHLDKLHAFWDKAHGFYTPETVSAHRRLSDDLNGGEALSATQRLECWQTLQQHQNGWRQG
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)



GGGTGGGS
TTSS


T
 .........360.........370.....
Sequence AEDWSRYLFGQPSAPEKLAAFVSKH
Predicted secondary structure





SS confidence
























Known secondary structure (DSSP) TS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D