Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wx3C_

Fold library idPDB HeaderMoleculeTitle
c5wx3C_1.80PDB header: transferaseChain: C: PDB Molecule: alkyldiketide-coa synthase;


Added to library: Sat Apr 29 08:22:13 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QAAVLAIATANPPNIFYQADYPDFYFRVTKSEHMTQLKDKFKRMCEKSMIRKRHMYLTEDVIKENPNIGI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)



S
GGGTT
TT
TT


S

SGGGGS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LNAPSFNARQEIMVEEVPKLGKEAALKAIKEWGQPLSKLTHLIFCTSSGVNMPSADYHLAKIMGLPPYVQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT


T

GGG

SS


SS
T

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RTMIYQQGCFAGATALRLAKDIAENNGGHTRILIVCVELMVVCFQAPSDTYLDLLVGNAIFSDGAAAAIV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S
GGG
TT

GGGT




TT
B

 .........220.........230.........240.........250.........260.........270.........280
Sequence GADLDTTTERPIFNIVSANQTTIPDSEDGIVGHIREMGMKYYLSRTVPQVIMFYIVHPGGPAVLRMMEEK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS

TTT


S
TT
TTSTT
TT



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LGLSKERMRASWHVLSEYGNMWGPSVLFILDEMRNKSMEEGKSTTGEGLEWGVMFGFGPGLTVETVVLRS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT


B
STTTT
SBTBTTBSTTT
 ...
Sequence VAI
Predicted secondary structure


SS confidence


Known secondary structure (DSSP)
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D