Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wvpA_

Fold library idPDB HeaderMoleculeTitle
c5wvpA_2.29PDB header: hydrolaseChain: A: PDB Molecule: beta-glucosidase;


Added to library: Sat Feb 3 08:34:57 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SMLGVPLEGFAEYSRIAAAEGGVLLKNENAMLPIRAHEIVSVFGRCQIDYYRSGTGSGGAVNVPYVVNIL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

TT


TTT

TT

S

TT
SGGGTS


S
BSGGG



S



 .........80.........90.........100.........110.........120.........130.........140
Sequence DGLRANPRIQVNEQLAKQYEQWIAENPFDNGGGGAAEPWCQKEMPLTDEIVAQAKQASSKAIVIIGRTAG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) STT

S




S



S
SS







S


B
 .........150.........160.........170.........180.........190.........200.........210
Sequence EDKDNADTEGSYRLTEQERLNLETVTRHFDQVAVLMNVANVIDMSWINDPVHQGRIRAVMFVWQGGMIGG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TTB


SSBTTTB


S

SS



GGGG
GGGTT





TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence HAVADLLSGDVTPSGKLPDTIAHHIEDYPSTANFGSEERNLYEEDIYVGYRYFETFCPDKVLFPFGYGLS
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) TSS





SS
SSGGGSTTGGG


SS
TTTT

T
GGG
TT

B
 .........290.........300.........310.........320.........330.........340.........350
Sequence YTSFAWKVQGVKLEGAGTDAQLEVQVEVTNTGSEFSGKEVIQLYYEAPQGVLGKPARALGAFAKTKLLQP
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SS
S
GGG


SS

B




TTT


S



B
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence GESDVLTLQLPVRRMASYDDGGYTGHKSCYVLEAGDYEFHVGNSIRNTERVTVDGKAAYQLAELMVVEQL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T
GGGG
SS
TTS
TT
SSSSSSTTSSS

 .........430.........440.........450.........460.........470.........480.........490
Sequence EEAAAPTQRFSRLKPGRRKPDGTYEIVREEVPQRTISLKERIERRLPEAYPQTGNRGIKLKDVQAGKASL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)


S


S


TTS





S











S

TSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence EEFVAQLSDEDLATIVRGEGMSSPKVTPGTASAFGGVGENLLEYGIPVACTADGPSGIRMDSGLKATQLP
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TT

T
SS
TTSSTT
SS
STTT


TTS


TT







 .........570.........580.........590.........600.........610.........620.........630
Sequence IGTLLASSWDVDLVESLYVLEGKELLQNEIDTLLGPGINIHRHPLNGRNFEYFSEDPYLTGCFASAVTRG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT
TT
S

B




STT
TTGGGS

S
 .........640.........650.........660.........670.........680.........690.........700
Sequence IKKGGSSATVKHFAGNNQEKARSKVDAVVSERALREIYLKGFEMAVKEGEATSIMTSYNPVNGHWAASNY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TS
BTT



TTTTT


TTSTS



SSTTGGG
 .........710.........720.........730.........740.........750.........760.........770
Sequence DLNTTILRNEWGYQGIVMTDWWAVMNDCVEGGPADLKNTSFMVRAQNDLYMVVNNDGAEINSLGDNTLEA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T





T


S

TT

B

TTT



BTT
T

B
TT
GGGTTT

S
 .........780.........790.........800.........810.........820.........830.........840
Sequence LANGTLTVGELQRCAMNICRFLLNAPALAREPKHEVRLIQAAQGDLPIASAGVNVYTLSRSQSAKVLANA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TSS
TSGGGTS









SS

GGGGSS
BTTB

SS
 .........850.........860.........870.........880.........890.........900.........910
Sequence ETAVVKVQEAGVYTVTAHIRYEALSQSACNLLLNGELLTTVQTNGTLGRWVTQKQLRIELTEGDYELKFD
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S
S






TTS

TT


S
 .........920....
Sequence YIKPGLEIEWIEFI
Predicted secondary structure




SS confidence













Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D