Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wvpA_

Fold library idPDB HeaderMoleculeTitle
c5wvpA_2.29PDB header: hydrolaseChain: A: PDB Molecule: beta-glucosidase;


Added to library: Sat Feb 3 08:34:57 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SMLGVPLEGFAEYSRIAAAEGGVLLKNENAMLPIRAHEIVSVFGRCQIDYYRSGTGSGGAVNVPYVVNIL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

TT


TTT

TT

S

TT
SGGGTS


S
BSGGG



S



 .........80.........90.........100.........110.........120.........130.........140
Sequence DGLRANPRIQVNEQLAKQYEQWIAENPFDNGGGGAAEPWCQKEMPLTDEIVAQAKQASSKAIVIIGRTAG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) STT

S




S



S
SS







S


B
 .........150.........160.........170.........180.........190.........200.........210
Sequence EDKDNADTEGSYRLTEQERLNLETVTRHFDQVAVLMNVANVIDMSWINDPVHQGRIRAVMFVWQGGMIGG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TTB


SSBTTTB


S

SS



GGGG
GGGTT





TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence HAVADLLSGDVTPSGKLPDTIAHHIEDYPSTANFGSEERNLYEEDIYVGYRYFETFCPDKVLFPFGYGLS
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) TSS





SS
SSGGGSTTGGG


SS
TTTT

T
GGG
TT

B
 .........290.........300.........310.........320.........330.........340.........350
Sequence YTSFAWKVQGVKLEGAGTDAQLEVQVEVTNTGSEFSGKEVIQLYYEAPQGVLGKPARALGAFAKTKLLQP
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SS
S
GGG


SS

B




TTT


S



B
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence GESDVLTLQLPVRRMASYDDGGYTGHKSCYVLEAGDYEFHVGNSIRNTERVTVDGKAAYQLAELMVVEQL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T
GGGG
SS
TTS
TT
SSSSSSTTSSS

 .........430.........440.........450.........460.........470.........480.........490
Sequence EEAAAPTQRFSRLKPGRRKPDGTYEIVREEVPQRTISLKERIERRLPEAYPQTGNRGIKLKDVQAGKASL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)


S


S


TTS





S











S

TSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence EEFVAQLSDEDLATIVRGEGMSSPKVTPGTASAFGGVGENLLEYGIPVACTADGPSGIRMDSGLKATQLP
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TT

T
SS
TTSSTT
SS
STTT


TTS


TT







 .........570.........580.........590.........600.........610.........620.........630
Sequence IGTLLASSWDVDLVESLYVLEGKELLQNEIDTLLGPGINIHRHPLNGRNFEYFSEDPYLTGCFASAVTRG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT
TT
S

B




STT
TTGGGS

S
 .........640.........650.........660.........670.........680.........690.........700
Sequence IKKGGSSATVKHFAGNNQEKARSKVDAVVSERALREIYLKGFEMAVKEGEATSIMTSYNPVNGHWAASNY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TS
BTT



TTTTT


TTSTS



SSTTGGG
 .........710.........720.........730.........740.........750.........760.........770
Sequence DLNTTILRNEWGYQGIVMTDWWAVMNDCVEGGPADLKNTSFMVRAQNDLYMVVNNDGAEINSLGDNTLEA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T





T


S

TT

B

TTT



BTT
T

B
TT
GGGTTT

S
 .........780.........790.........800.........810.........820.........830.........840
Sequence LANGTLTVGELQRCAMNICRFLLNAPALAREPKHEVRLIQAAQGDLPIASAGVNVYTLSRSQSAKVLANA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TSS
TSGGGTS









SS

GGGGSS
BTTB

SS
 .........850.........860.........870.........880.........890.........900.........910
Sequence ETAVVKVQEAGVYTVTAHIRYEALSQSACNLLLNGELLTTVQTNGTLGRWVTQKQLRIELTEGDYELKFD
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S
S






TTS

TT


S
 .........920....
Sequence YIKPGLEIEWIEFI
Predicted secondary structure




SS confidence













Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D