Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wvmA_

Fold library idPDB HeaderMoleculeTitle
c5wvmA_2.90PDB header: sugar binding proteinChain: A: PDB Molecule: maltose-binding periplasmic protein,two-component system


Added to library: Sat Jan 6 08:24:19 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

SS

TTS




SSTTT
S
SS
STTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT
B





TB
TTTT
S

TTT
SS

SBSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence KGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT




SSTS

S
SSSTTS
TTSS
TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence IAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTS
GGGTT





BBTTB



BTT
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTSSS


SBTTSS


STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SGRQTVDEALKDAQTNAAAHMRGFIDYIKSSNEQRINMLSEALEEQYSHHGNWIFLRNNDQVVYQIMRSF
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TSSS
TTTTSSTT

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence EQNSDSSHNLPPKGWRTQFWVVDSQFNRLVGHSGPLPKEGPRHPIRYNNEIVGWVLTTPVERLTRNTDIN
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) T






TTTTTT
TT

S
SS


SSS
SSSS


GGGSTTTTT
 ..
Sequence FD
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D