Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wutB_

Fold library idPDB HeaderMoleculeTitle
c5wutB_1.60PDB header: hydrolaseChain: B: PDB Molecule: ulam111;


Added to library: Sat Jan 6 08:18:13 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KLVWEEHFNGKELDTKNWNFELGDGCPNCGWGNSERQLYTKTNHKMENGKLVITAKKEGTQYTSTRITTQ
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)



SSS

TTT


BT
TTSGGGGTT


SSSTTTT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GKKEFQYGYIEARAKLPVGKGIWPAFWMLGSNIKTVGWPQCGEIDILEYVGKEPHMVFTSLHTTASHGNT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTSSS


STTTT
TTTT


TTSTT
SSS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence INTKRTRIDTIEQGFHLYAIDWTKDKMDFFVDNILVYTFNPTDKTEAIWPYDQPFYFIINMAIGGNFGGP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SS
TTTTSS
SS
TT

SS

TTT


SS
S
S
 .........220.........230
Sequence EVDDAIFPQDFSIDYIKVYQ
Predicted secondary structure









SS confidence



















Known secondary structure (DSSP)


GGG
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D