Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wusA_

Fold library idPDB HeaderMoleculeTitle
c5wusA_2.20PDB header: hydrolaseChain: A: PDB Molecule: chitinase;


Added to library: Sat Dec 30 08:42:53 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPQVLCYLTSWSSKRPSAGRFMPENVDPTLCTHVIYAFATLKDHKLTEADEKDADMYDKVVALREKNPNL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

GGGGGS
GGG


GGG

TTT
SSSSS
SSTTTTSGGG
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KILLAIGGWAFGSTPFKELTSNVFRMNQFVYEAIEFLRDYQFNGLDVDWEYPRGADDRAAFVSLLKELRL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TTT
STSST
S
S


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence AFEGEAKTSGQPRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPLFPLESA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SSS







S


SS
TTSSB


SS
SS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TSYQKKLTVDYSAREWVRQGAPKEKLMIGMPTYGRSFTLINDTQFDIGAPASGGGQAGRFTNEAGFMSYY
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
TTGGGSSTT

GGGSSSTT

STT
B




TTT

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence EICEFLREDNTTLVWDNEQMVPFAYREDQWVGFDDERSLKTKMAWLKEEGFGGIMVWSVDMDDFRGSCGT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TSTT
TTTTTT


T


GGGS
TT
TTSS
 .........360.........370.....
Sequence GKYPLITAMKQELSGYKVKLEYDGP
Predicted secondary structure












SS confidence
























Known secondary structure (DSSP)
SSTT










Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D