Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wtlB_

Fold library idPDB HeaderMoleculeTitle
c5wtlB_2.30PDB header: membrane proteinChain: B: PDB Molecule: ompa family protein;


Added to library: Sat Dec 16 08:49:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DTDKDGIPDNKDACPEVPGLKEFNGCPDTDGDGIPDKDDACPQVKGPKEFNGCPDTDGDGIPDKDDACPE
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)

S
SSS
GGG
SSSSS

BGGGTTB

TT
SSS
TTT
SSTTS


GGGTT


TT
SSS
GGG
SSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VAGPKEFNGCPDTDGDGIPDKDDKCPDVAGPAENGGCPWPDTDGDGVLDKDDLCPEVAGPASNKGCPEPD
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S


GGGTT


TT
SSS
GGG
SSTTS


GGGTTS



TT
SSS
TTT
SSTTS


TTTTT




 .........150.........160.........170.........180.........190.........200.........210
Sequence EKEQKQLNQYAKTILFDTGKATIKFQSAEVLNQIINVLKKYPNSRFRIEGHTDSTGKKAKNMILSQNRAD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT

B
TTS

B
GGG
TT



S
S
 .........220.........230.........240.........250........
Sequence AVKVYLIQGGIDAGRLESQGFGPEKPIASNKNKKGRELNRRVEINLIK
Predicted secondary structure



















SS confidence















































Known secondary structure (DSSP) TT

GGGTSS
SS
TTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D