Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wtlB_

Fold library idPDB HeaderMoleculeTitle
c5wtlB_2.30PDB header: membrane proteinChain: B: PDB Molecule: ompa family protein;


Added to library: Sat Dec 16 08:49:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DTDKDGIPDNKDACPEVPGLKEFNGCPDTDGDGIPDKDDACPQVKGPKEFNGCPDTDGDGIPDKDDACPE
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)

S
SSS
GGG
SSSSS

BGGGTTB

TT
SSS
TTT
SSTTS


GGGTT


TT
SSS
GGG
SSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VAGPKEFNGCPDTDGDGIPDKDDKCPDVAGPAENGGCPWPDTDGDGVLDKDDLCPEVAGPASNKGCPEPD
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S


GGGTT


TT
SSS
GGG
SSTTS


GGGTTS



TT
SSS
TTT
SSTTS


TTTTT




 .........150.........160.........170.........180.........190.........200.........210
Sequence EKEQKQLNQYAKTILFDTGKATIKFQSAEVLNQIINVLKKYPNSRFRIEGHTDSTGKKAKNMILSQNRAD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT

B
TTS

B
GGG
TT



S
S
 .........220.........230.........240.........250........
Sequence AVKVYLIQGGIDAGRLESQGFGPEKPIASNKNKKGRELNRRVEINLIK
Predicted secondary structure



















SS confidence















































Known secondary structure (DSSP) TT

GGGTSS
SS
TTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D