Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wt2A_

Fold library idPDB HeaderMoleculeTitle
c5wt2A_2.30PDB header: transferaseChain: A: PDB Molecule: cysteine desulfurase iscs;


Added to library: Sat Dec 16 09:40:11 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VQRIYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINARDIDDVIITS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



BTTT




TT



TT
SSTTTT

TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence CATESNNWVLKGVYFDECLKKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVREAI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTTT


TTS
TT



TTSS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence TEKTALVSVMWANNETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHKFHGPK
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
TT

SB
TTT
BB

TTT

TTTTTTS


T
SGGGTTS
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence GIGGLYIRSGVGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLK
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S

TT




SS
SS
STTTTS
S


TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IPDVMVVGDRIHRVPNTTLVSVRGIEGEAMLWDLNRSNIAASTGSATAIRLSLSRFNTEAEIDKTIEVFS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) STT
S
SSSB
TTSSS
TT





TT

 .....
Sequence QAAVR
Predicted secondary structure
SS confidence




Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D